Showing posts sorted by relevance for query Lilo. Sort by date Show all posts
Showing posts sorted by relevance for query Lilo. Sort by date Show all posts

Sunday, November 20, 2022

Lilo

Lilo (pronounced lahy-loh)

(1) The trademark for a type of inflatable plastic or rubber mattress, often used when in lakes, swimming pools etc.

(2) As a generic term, any inflatable mattress, especially those used recreationally in lakes, swimming pools etc).

(3) The portmanteau slang synonym for Li(ndsay) Lo(han); it was also applied as the name of a dance Ms Lohan performed ad-hoc on the Greek island of Mykonos in 2018.

(4) As LILO, the acronym for Li(nux) Lo(ader), an early (1991-2015) boot loader for the Linux operating system.

(5) As LILO, in computing, organizational management, accountancy and behavioral science, as the acronym for L(ast) I(n), L(ast) O(ut), a companion unit descriptor to FIFO (First In, First Out) & FILO (First in Last Out), all methods with which to organize the manipulation of data structures.  Under LILO, the last object in a queue is the last object to leave the queue.

1944: The trademark name Lilo (originally Li-Lo) registered by the company which made inflatable air-mattresses of rubberized canvas dates from the 1940s (1944 in the UK; 1947 in the US) and was a sensational spelling based on the phonetic “lie low”.  Lilo also exists in other languages: In the Philippines, in the Cebuano language a lilo is a swirling body of water or a large and violent whirlpool (a maelstrom) while in Tagalog it’s an adjective meaning disloyal; unfaithful; traitorous; treacherous (the synonyms being taksil, sukab, mapagkanulo & traydor).  In Hawaiian, Lilo is a feminine given name meaning “generous one” although in some traditions in the islands it can be translated as “lost” so the song He Mele No Lilo translates (loosely) as “Lullaby of the Lost”.  Lilo is a noun, the noun plural is lilos.

The Li-Lo Kayak, 1960.  The car depicted is a stylized rendition of an early version of one from the Rootes Group's "Audax" range (1956–1967).

The technology of the lilo was adaptable and able to assume various shapes, the LiLo company dabbling in a number of market niches including furniture, packaging and inflatable canoes.  The Kayak however was complex in construction so its production was thus labor intensive so it never sold in the numbers required to achieve the economies of scale which could have lowered the price and at Stg£25 (over Stg£500 in 2022 values) it was too expensive to succeed.  The idea has however been revived in the twenty-first century and "lilo & inflatable kayak" adventure tourism is now a thing.

The Bravissimo Lilo

The joke which buyers took seriously: the Bravissimo Lilo.

Bravissimo's Lilo appeared originally in 2018 as an April Fools' prank but such was the demand it was put into production and is now Bravissimo part-number SW571, available exclusively in hot pink.  Although there have since the 1940s been improvements in materials (lilos are made usually from polyvinyl chloride (PVC) or textile-reinforced urethane plastic or rubber), the innovation on Bravissimo's is the first structural change in design in seventy-five years.  Integrating what the manufacturer calls “cup holders” the unique feature is a one-size-fits-all lacuna at the appropriate position so the breasts may comfortably rest un-squished when a woman is supine, lying face-down

Room to move: One size fits all.

Even Bravissimo, an underwear company which specializes in the niche of bigger boobs, admits they really should have thought of this before, given the discomfort suffered by lilo-using women tends to increase in direct proportion to cup-size.  It’s available in-store in some Bravissimo outlets and on-line at Stg£28 (US$45).

No longer one size fits all: Crash test dummies (CTD) now more inclusive.

Perhaps Bravissimo being nudged into making available a lilo which took account of women's unique anatomical differences inspired others because, some fifty years after they came into use, Swedish engineers have at last developed a crash-test dummy (CTD; "seat evaluation tool" the technical term) representative of the body of a typical woman.  Until now, almost all CTDs have been based on the build and weight of a typical adult male.  In most markets however, women however have long represented about half of all drivers and passengers yet the CTD manufacturers and regulators used in testing as a proxy for women was a scaled-down version of the male one, roughly the size of a typical girl of twelve and at 1.49m (4', 8") and weighing 48kg (106 lb), in accord with only the smallest 5% of women by the standards of the mid-1970s.  The new CTD is a more representative 1.62 m (5', 3") tall, weighing in at 62kg (137 lb) so it's another DEI (diversity, equity and inclusion) building block. 

The need for a range of CTD with characteristics covering most of the population was discussed in the 1960s when US regulators began to write the first standards for automotive safety but industry lobbyists did their work and ensured crash-testing would be done as cheaply as possible, hence the standard, one-size-fits-all male analogue.  Despite years of convincing research which confirmed women were disproportionately injured in crashes (height rather than weight apparently the critical variable in the interaction of their smaller frames with seat-belts and air-bags), it wasn't until 2011 that US federal regulators required manufacturers to use more petite CTDs in frontal automotive crash tests.  It's hoped the new, Swedish-developed CTD will improve outcomes and the data from physical testing will soon be available for use in the increasingly important computer emulations, a field in which artificial intelligence (AI) is proving useful.

Lindsay Lohan: Studies of Lilo lying low in three aspects.

Lindsay Lohan’s moniker LiLo is a blend, the construct being Li(ndsay) + Lo(han).  Being based on proper nouns, in linguistics this would by most be regarded a pure blend, although some would list it as a portmanteau which is a special type of blend in which parts of multiple words are combined into a new word (and some insist that in true portmanteaus there must be some relationship between the source words and the result).

Saturday, September 26, 2020

Moniker

Moniker (pronounced mon-i-ker)

(1) A personal name or nickname as an informal label, often drawing attention to a particular attribute; sometimes also used in commerce.

(2) In computing, an object (an instance of structured data) used to associate the name of an object with its location; many coders prefer “tag”.

1849: Moniker is perhaps from the Irish Shelta munik, munikamŭnnik (name), said to be a permutation and extension of Irish ainm (name).  Earlier scholars said it was originally a hobo term, dating it from 1851 and of uncertain origin, perhaps from monk (monks and nuns take new names with their vows) and noted British tramps of the period referred to themselves as “in the monkery”.  Monekeer is attested among the London underclass from 1851 and there were those who claimed to detect “a certain Coptic or Egyptian twang” but, given the uncertainty, all conclude the origin can be only uncertain and the ideas of it being (1) a back-slang of the Middle English ekename (the construct being eke (also, additionally) +‎ name), (2) a corruption of monogram (in the sense of “a signature”), (3) from monarch in the egotistical sense of “I, myself” or (4) from “monk” (monks and nuns take new names with their vows) are all speculative and there’s certainly no link with the primitive Indo-European root no-men (name).  The (rare) alternative forms were monacer, monicker & moniker. Moniker is a noun; the noun plural is monikers.

Lindsay Lohan doing the LiLo, Mykonos, Greece, 2018.

Lindsay Lohan’s moniker LiLo is a blend, the construct being Li(ndsay) + Lo(han).  Being based on proper nouns, in linguistics this would by most be regarded a pure blend, although some would list it as a portmanteau which is a special type of blend in which parts of multiple words are combined into a new word (and some insist that in true portmanteaus there must be some relationship between the source words and the result).  As a proper noun in its own right, “Lilo” means “generous One” and its origin is Hawaiian although in some traditions in the islands it can be translated as “lost”.  The LiLo name was also adopted as the name of an impromptu dance Ms Lohan performed in 2018 at the Lohan Beach House on the Greek Island of Mykonos.

English has a tradition of accumulation many words to mean much the same thing and this can be handy because it allows nuances of use to emerge.  Moniker has as one of those words which, despite there being many better-known and probably better understood synonyms, offers variety, a linguistic flourish that doesn’t suffer the boring familiarity of “nickname” or the dubious connotations of “alias”.  The other related forms include epithet, byname, pseudonym, sobriquet pen-name & to-name.  By some typically strange process, in English the French nom de plume (pen-name) is common whereas among the French nom de guerre (literally, “name of war”, referring to the pseudonyms used during wars) is used for all purposes.  The more recent creation "nom de Web" was a humorous coining for those operating on the internet under a cloak of anonymity although for those who object to mixing linguistic sources for such things there was also nom de clavier, the construct being the French nom (name) + de (of) + clavier (keyboard).  Of course, even someone using a nom de clavier will be able to pay their monthly US$8 and attach to it a Twitter blue tick.

The moniker in modern US politics

Monikers in politics are nothing new but Donald Trump’s 2016 campaign for the Republican nomination and subsequently the presidency then and in 2020 was an example of democratic politics adopting the techniques of reality television and his application of derisive monikers to his opponents proved quite effective in 2016.  The campaign team took the idea seriously from the start, workshopping the possibilities in focus groups to find which gained the best response.  It turned out, based on data from the focus groups there was nothing to choose between crooked Hillary and lying Hillary (as one might imagine) but this was just another big TV show so Trump picked the one he preferred.  Crooked Hillary’s loss was Ted Cruz’s gain: He became Lyin’ Ted which was remembered when, rather than sharing the cold with his those who he represents when Texas froze under a polar vortex, the flew off to sunny Mexico for a vacation.  He was immediately dubbed flyin’ Ted.  The monikers are also recycled “crazy” briefly tried for crooked Hillary, used for Bernie Sanders and later for Liz Chaney, the last use probably because of the attractiveness of the cadence.  The opposing campaign teams noted both phenomenon and effect but all decided they either didn’t wish to adopt the technique or it was too late and to come up with a dirty Donald or cheating Donald or whatever, would have seemed an unoriginal reaction.  They were probably right to resist temptation.

The class of 2016: (1) Tez Cruz: Lyin’ Ted, (2) Marco Rubio: Little Marco, (3) Elizabeth Elizabeth Warren: Pocahontas, (4) Pete Buttigieg: Alfred E Neuman, (5) Michael Bloomfield: Mini Mike, (6) Jeb Bush: Low Energy Jeb, (7), Hillary Clinton: Crooked Hillary, (8) Bernie Sanders: Crazy Bernie.

Some of the memorable monikers Mr Trump has deployed over the years include: Wacky Bill Cassidy, Sleepin' Bob Casey, Low-Polling Liz Cheney, Wacky Susan Collins, Leakin' James Comey, Shadey James Comey, Slimeball James Comey, Slippery James Comey, Ron DeSanctimonious (Ron DeSantis), Leaking Dianne Feinstein, Jeff Flakey, (Jeff Flake), Rejected Senator Jeff Flake, Al Frankenstein (Al Franken), Lightweight Senator Kirsten Gillibrand, Nasty Kamala (Kamala Harris) Phony Kamala Harris, Corrupt Kaine (Tim Kaine), Cryin' Adam Kinzinger, Senator Joe Munchkin (Joe Manchin), Broken Old Crow (Mitch McConnell), Evan McMuffin (Evan McMullin), Disaster from Alaska (Lisa Murkowski), Fat Jerry (Jerry Nadler), Eva Perón (Alexandria Ocasio-Cortez), Foul Mouthed Omar (Ilhan Omar), Dummy Beto (Beto O'Rourke), Truly weird Senator Rand Paul, Nancy Antoinette (Nancy Pelosi), Nervous Nancy Pelosi, The Nutty Professor (Bernie Sanders), Adam Schitt (Adam Schiff), Pencil Neck (Adam Schiff), Weirdo Tom Steyer, Goofy Elizabeth Warren, Low-IQ Maxine Waters, That woman from Michigan (Gretchen Whitmer) and Gretchen Half-Whitmer (Gretchen Whitmer).

Sleepy Joe and wife on the campaign trail, 2020.

Even Trump however probably had to reign in his worst instincts, of which there are many.  He must have been tempted to persist calling Joe Biden sleepy-creepy Joe because of the long history of hair-sniffing photographs but, given his own record of locker-room talk, perhaps thought an allusion to senility might be safer.  Sleepy Joe it became although he’d previously flirted with Corrupt Joe, Basement Biden, Beijing Biden, China Joe, Quid Pro Joe and Slow Joe.  Had it been twenty years earlier, he’d probably have dismissed Pete Buttigieg with the gay slur "Mayor Buttplug" but times have changed although the fantasy (which really does exist among some in the Democratic Party's more delusional factions) of Buttigieg appearing somewhere on a presidential ticket remains.  However well such a candidacy might play in San Francisco or New York City, south of the Mason-Line, there are still many who think of Buttigieg's proclivities as such things were criminalized in statute in the time of Henry VIII (1491–1547; King of England (and Ireland after 1541) 1509-1547): “the detestable and abominable vice of buggery”.  Mr Trump's team seemed to struggle to find some way successfully to disparage Buttigieg, finally picking up a reference to the Mad Magazine character Alfred E Neuman.  Buttigieg successfully deflected that echo from the analogue age, claiming never to have heard of Alfred E Neuman and suggesting it might be a “generational thing”, the cultural moment having passed.  It may also have been a good tactic; Ronald Reagan’s campaign staff never cared if anyone said he was too ignorant to be president but worried greatly if anyone hinted he was too old.  All the same, between Buttigieg and Neuman, there is some resemblance.

The pot calling the kettle black: Donald Trump in action.

One of the more recent to emerge was Ron DeSanctimonious to describe Florida Governor Ron DeSantis who a well-regarded betting site currently lists as the $2.10 favorite for the Republican presidential nomination in 2024 with Mr Trump at $3.10 and all others as outsiders.  Perhaps surprisingly, the Democrat field is more closely contested although Sleepy Joe remains the favorite though it’s a long way out and even Crooked Hillary Clinton is at only $26.00 which doesn’t seem long odds considering the history.  Ron DeSanctimonious has lots of syllables so isn’t as punchy as some of the earlier monikers but Mr Trump has a habit of trying them out to see how they catch on and replacing anything which doesn’t work and in the 2022 Florida gubernatorial election he confirmed he voted for DeSantis so there's that.  However, long words can work well if they roll easily off the tongue which is why Pocahontas gained resonance.  Donald Trump dubbed Elizabeth Warren Pocahontas because of her claim to Native American ancestry which proved dubious but others were more clever still, referring to her as Fauxcahontas.  That was actually an incorrect use necessitated by the need of rhyme and word formation; technically she was a Fakecahontas but as a word it doesn’t work as well.  People anyway seemed to get the point: as a Native American, she was fake, bogus, phoney.

Mr Trump in November 2022 announced he'd be seeking the Republican Party's nomination again in 2024 so monikers old and new might again be deployed although, gloating somewhat over the disappointing performance of Trump-aligned candidates in the mid-term elections, Rupert Murdoch's tabloid The New York Post ran the headline "Trumpty Dumpty Had a Great Fall".  The Trumpty Dumpty line wasn't original, memes and books having circulated for years, but, News Corp having given the lead, it'll be interesting to see if that starts a trend among what Mr Trump calls "the fake news media".       

Tuesday, May 10, 2022

Portmanteau

Portmanteau (pronounced pawrt-man-toh)

(1) A case or bag to carry clothing in while traveling, made usually from stiff leather, hinged at the back so as to open out into two compartments

(2) A word created by blending two or more existing words.

1580s (for the travelling case (flexible traveling case or bag for clothes and other necessaries)): From the Middle French portemanteau (travelling bag, literally "(it) carries (the) cloak").  The original meaning from the 1540s was “court official who carried a prince's mantle" from porte, (imperative of porter (to carry) + manteau (cloak)).  The correct plural is portmanteaux but in modern English use, portmanteaus (following the conventions for constructing plurals in English) is now more common.  In the nineteenth century, the word was sometimes Englished as portmantle, a use long extinct.  The notion of the portmanteau word (word blending the sound of two different words) was coined by Lewis Carroll (pen-name of Charles L. Dodgson; 1832-1898) in 1871 for the constructions he invented for Alice Through the Looking-Glass such as Jabberwocky, his poem about the fabulous beast the Jabberwock.  Portmanteau in this sense has existed as a noun since 1872.

Vintage Louis Vuitton Portmanteau, typically circa US$50-80,000 depending on condition.

A portmanteau word, a linguistic blend, differs from contractions and compounds.  Contractions are formed from words that would otherwise appear together in sequence, such as do + not to make don't, whereas a portmanteau word is joins two or more words that relate to the one contractual theme.  A compound word is merely the joining for words in their original form (eg under + statement) without any truncation of the blended words.  Portmanteau words (eg breakfast & lunch to create brunch) always modifies at least one of the original stems.

Lindsay Lohan's handy moniker Lilo (the construct being Li(ndsay) + Lo(han) and it's used sometimes as LiLo) is a portmanteau word.

The word portmanteau was first used in this sense by Lewis Carroll in Alice Through the Looking-Glass (1871) where the concept is helpfully explained by Humpty Dumpty.  Less erudite but just as amusing was the creation of refudiate by Sarah Palin when she got confused and conflated refute and repudiate although it’s unclear whether she knew the meaning of either.  Even those created or used by more literate folk are not always accepted.  Irregardless (portmanteau of regardless and irrespective) seems to stir strong feelings of antipathy in pedants who generally won’t accept it even as a non-standard form and insist it’s simply wrong.  Other languages also create blended forms as needed.  The title of Emile Habibi’s 1974 novel was translated from Arabic utashaʔim (pessimist) + mutafaʔil (optimist) into English as The Pessoptimist.  Arabic linguistic traditions however prefer acronyms and compounds which sometimes overlap.  The group known variously as ISIL or ISIS (although they came to prefer "caliphate" or "Islamic State" (IS)) first adopted the name ad-Dawlah al-Islāmiyah fī 'l-ʿIrāq wa-sh-Shām (Islamic State if Iraq and the Levant) which is usually written as Daesh or Da'ish.  IS think this derogatory as it resembles the Arabic words daes (one who tramples underfoot) and dāhis (those who sows discord).  IS threatened to punish those who use Daesh or Da'ish with a public flogging; repeat offenders promised the cutting out of the tongue.

In the manufacture of big words, English is unlikely ever to match the Germans.  Until changes in EU regulations rendered it obsolete, the longest word in the Fourth Reich was rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz (law delegating beef label monitoring).  Currently, the longest word accepted by German dictionaries is kraftfahrzeughaftpflichtversicherung (automobile liability insurance), editors rejecting donaudampfschifffahrtsgesellschaftskapitaenswitwe (widow of a Danube steamboat company captain) because of rarity of use.

Thursday, January 12, 2023

Simonize

Simonize (pronounced sahy-muh-nahyz)

(1) To polish the exposed surfaces of an automobile (specifically using Simoniz brand products; later used generically).

(2) To shine or polish something to a high sheen, especially with wax.

Circa 1921: A creation of US English meaning "polish by the application of Simoniz wax”, from Simoniz, the registered trademark for a brand of car polish invented by George Simons who, in association with Elmer Rich of the Great Northern Railway, in 1910 formed the Simons Manufacturing Company (Chicago) to produce and sell the products.  The construct was Simoniz + “e”, the addition an emulation of the –ize prefix  Said to have been in oral use since circa 1921, lexicographers began to add simonize (as a verb with the noted meaning) to dictionaries in 1935.   In the English-speaking world, the word often appeared (outside North America) as simonise.  Simonize, simonized & simonizing are verbs.

The –ize suffix was from the Middle English -isen, from the Middle French -iser, from the Medieval Latin -izō, from the Ancient Greek -ίζω (-ízō), from the primitive Indo-European verbal suffix -idyé-.  It was cognate with other verbal suffixes including the Gothic -itjan, the Old High German –izzen and the Old English -ettan (verbal suffix).  It was used to form verbs from nouns or adjectives which (1) make what is denoted by the noun or adjective & (2) do what is denoted by the noun or adjective.  The alternative form is –ise.  Historically, the –ize suffix was used on words originating from Greek while –ise was preferred (most prevalently as -vise, -tise, -cise and –prise) on words derived from various roots, many of which entered English via French.  In the nineteenth century, under the influence of French literature, in the UK and other parts of the British Empire, -ise often replaced –ize even when there was a long tradition of the latter’s use.  The authoritative Oxford English Dictionary (OED) never changed its spellings which meant that throughout the Empire (and later the Commonwealth), both forms appeared and before the advent of spell-checkers (which ensured that at least within a given document there was consistency) use was mixed although, under the Raj and beyond, India tended to stick to –ise.  The –ize has always been the preferred form in North America.

Spa day service station, Connecticut Avenue. Washington DC, September 1940 (left) and Kimble Garage and Gas, Harrison Street, Fort Wayne, Indiana, circa 1937.

Although the verb simonize rapidly came to mean (in a generic sense) “to shine or polish something to a high sheen, especially with wax”, one of the early conditions imposed to permit the advertising of “Simonizing” as a service was the exclusive use of genuine Simoniz brand products.  So, the “Simonizing” bay was where one's car was taken to be simonized with Simoniz Wax (and other of the brands products) while if in the “Lubritory”, one's car would be lubricated which meant changing the oil as required (engine, gearbox, differential) and greasing the many lubrication points.  Although “one-shot lubrication” systems (a central reservoir of grease which, active by a lever or plunger, delivered a measured shot of grease to various chassis points) began to appear in some more expensive cars in the mid-1920s, it never became universal and by the late 1960s had been almost wholly replaced by the use of sealed, permanently lubricated components.

One reason companies registered trademarks used to be a wish to control the use of the name, businesses wishing to prevent their exclusive brand becoming so popular it came to be used to describe, and to some extent even define, all similar products.  The process was called genericide by the experts in business and marketing, the idea being that in becoming a generic term, some of the value invested in the product and its name was transferred to competitors.  The classic example was the vacuum cleaner made by Hoover, the word catching on to the extent that within years, just about all vacuuming came to be called “hoovering”, regardless of the manufacturer of the device doing the sucking.  The problem was that while trademark holders could restrict their use by corporations, what the public did was beyond their control and language just evolved by popular use.

The early Xerox photocopiers were always advertised as devices to be used by women.

The literature often cites Xerox as an example of the problem of the public perception of a corporation being defined in their imagination by its best known product.  The phrase “xerox it” had by the late 1960s become the default expression meaning “photocopy it” and was of concern to the corporation because they feared their differentiation in the market place would be lost.  Time however change and now, Microsoft would doubtless be delighted if “bing it” became as much a term of everyday speech as “google it”.  That is of course a little different because “Bing” is one of Microsoft’s many trademarks rather than the corporate name but the modern view now generally is that the public “verbing-up” a trademark is a very good thing and an easy way to extend the prized “brand awareness”.

The perfect secretary did much "xeroxing" but according to Xerox, would never say "xerox it".

Twitter’s case is a variation on the theme and a case study on how such matters must be managed.  The verb form “to tweet” became a verb through popular use which induced Twitter to trademark the term in 2009.  From there, the company announced they would not seek to restrict its use by third parties using “tweet” for Twitter-related services and apps but warned they would seek both injunctive relief and damages were there evidence of a “confusing or damaging project” to “to protect both our users our brand."  What Twitter wanted to do was ensure “tweet” was used in a way beneficial and not detrimental to them.

The Great Crash of 2005

Crashed and towed, Los Angeles, 2005.

In October 2005, Lindsay Lohan went for a drive in her Mercedes-Benz SL 65 AMG roadster.  It didn’t end well.  Based on the R230 (2001-2011) platform, the SL 65 AMG was produced between 2004-2012, all versions rated in excess of 600 horsepower, something perhaps not a wise choice for someone with no background handling such machinery though it could have been worse, the factory building 400 (175 for the US market, 225 for the RoW (rest of the world)) of the even more powerful SL 65 Black Series, the third occasion since 1954 a SL was offered without a soft-top and the second time one had been configured with a permanent fixed-roof.  A production number of 350 is sometimes quoted for the R230 Black Series but those maintaining registers insist it was 400.

Fixed and simonized, Texas, 2007.

By 2007, the car (still with California registration plates (5LZF057) attached) had been repaired, detailed & simonized and was being offered for sale in Texas, the odometer said to read 6207 miles (9989 km).  Bidding was said to be “healthy” so it was thought all's well that ends well but once the vehicle's provenance was brought to the attention of the repair shop, it was realized the celebrity connection might increase its value so it was advertised on eBay with more detail, including the inevitable click-bait of LiLo photographs.  However, either eBay doesn't approve of commerce profiting from the vicissitudes suffered by Hollywood starlets or they'd received a C&D (cease & desist) letter from someone's lawyers and the auction ended prematurely.  It proved a brief respite, the SL 65 soon back on eBay Motors but with the offending part of the blurb limited to "previously owned by high profile celebrity", leaving it to prospective buyers to join the dots.  According to Business Insider, the car sold for US$111,000 which was much higher than would be expected for one which had been repaired after an accident, albeit it a low-speed impact.  The R230s anyway had a complex construction and the AMG versions added even more intricacy so although it is possible to restore a damaged AMG to the state in which it left the factory, it does require both expertise and some often expensive parts.  Because of that, repaired Mercedes-Benz AMG cars trade usually at a significant discount so the amount realized was indicative of the perceived value of a celebrity association.

Thursday, February 15, 2024

Roadster

Roadster (pronounced rohd-ster)

(1) An early automobile having an open body, a single seat for two or three persons, and a large trunk or a rumble seat.

(2) A horse for riding or driving on the road (archaic).

(3) A two-seater, convertible sports car.

(4) A sea-going vessel riding at anchor in a road or bay.

(5) In coastal navigation, a clumsy vessel that works its way from one anchorage to another by means of the tides.

(6) A bicycle, or tricycle, adapted for common roads, rather than for the racing track, usually of classic style and steel-framed construction (archaic).

(7) Slang for one who drives much or one who lives along the road (UK) archaic).

(8) Slang for a hunter who keeps to the roads instead of following the hounds across country (archaic).

(9) The pre-modern class of racing car most associated with the classic era of the Indianapolis 500 (1952-1964).

1735–1745: A compound word, road + -ster.  Road was from the Middle English rode & rade (ride, journey) from the Old English rād (riding, hostile incursion) from the Proto-Germanic raidō (a ride), from the primitive Indo-European reydh (to ride). It was cognate with raid, a doublet acquired from the Scots, and the West Frisian reed (paved trail/road, driveway).  The –ster suffix is applied to someone (or something) associated with an act or characteristic, or does something specified.  It’s from the Middle English –ster & -estere from the Old English -estre (-ster, the feminine agent suffix), from the Proto-Germanic –istrijǭ &, -astrijǭ from the primitive Indo-European -is-ter- (suffix).  It was cognate with the Old High German -astria, the Middle Low German –ester and the Dutch -ster.  Roadster is a noun; the noun plural is roadsters.

Roadsters, gullwings and courtesans

1920 Stutz Bearcat (1912-1934 and in the first season spelled Bear Cat).  One of the fastest and most admired American cars of the early era, the Stutz Bearcat assumed such a place in popular culture, it was was claimed that should anyone die at the wheel of a Stutz Bearcat, they were granted an obituary in the New York Times (NYT).  Wholly apocryphal, the origin of the romantic myth is thought to be related to the Bearcat being a symbol of wealth, adventure, and daring, owned by the sort of chaps (such a lifestyle at the time was most associated with men although women adventurers were not unknown) who would likely anyway warrant an NYT obituary.

In the United States of the mid-nineteenth century, a roadster was a horse suitable for travelling and by the early 1900s, the definition had expanded to include bicycles and tricycles.  In 1916, the US Society of Automobile Engineers (SAE) defined a roadster as "an open car seating two or three”, a meaning which endures to this day.  Despite the origins, use was patchy in the US with the word applied to vehicles as diverse as the front-engined USAC (Indy) racing cars of the 1950s, a variety of 1930s convertibles and the custom post-war creations otherwise known as hot-rods.

Two of the 1963 Kurtis Kraft Roadsters which ran at the 1963 Indianapolis 500.  Car 56 (Jim Hurtubise (1932–1989)) qualified 3rd (150.257 mph (241.815 km/h)) but retired on lap 102 after suffering an oil leak.  Car 75 (Art Malone (1936–2013)) qualified 25th (148.343 (238.735 km/h)) but retired on lap 18 with clutch failure.

Both Kurtis Kraft Roadsters used the supercharged, double overhead camshaft (DOHC) Novi V8 (167–183 cubic inch (2.7–3.0 litres)) which appeared on the Indy 500 grid between 1941-1966.  The Novi was famous for the howl it produced at full cry but it never achieved its potential because chassis and tyre technology didn’t advance to the point its prodigious power could successfully be handled, the adoption of an all-wheel-drive (AWD) platform (then still referred to as four-wheel-drive (4WD) which now is usually reserved for vehicles which claim some off-road capability) coming too late.  The Novi V8 and is sometimes compared to the 1.5 litre (91 cubic inch) BRM V16, another charismatic, supercharged, small displacement engine with a narrow power band.  The unusual fin on car 75 was an attempt to improve straight-line stability, an approach often used in the era before the implications of down-force fully were understood.

The Indy folklore is the adoption of the term “roadster” to describe the final era of the front-engined cars was the result of an act of subterfuge.  What defined the “Indy Roadster” was the engine and drive shaft being offset from the center-line of the car, something which allowed the driver to sit lower in the chassis thereby optimizing the weight distribution for use on (anti-clockwise) oval tracks.  It was in 1952 quite an innovation and the legend is that whenever there were visitors in their workshop, the Kurtis team covered the chassis with a tarpaulin and if asked, casually dismissed what lay beneath as “just our roadster” (then a common term for a “hot rod”, a hobby which became popular in the post-war years).  The name stuck when the car appeared, the design for a decade the dominant configuration in open-wheel oval racing although the writing was on the wall in 1961 when Jack Brabham (1926–2014) appeared at the brickyard in an under-powered mid-engined Cooper Climax which, although out-paced by the roadsters on the straights, posted competitive times because of its superior speed in the curves.  After that, the end of the roadster era came quickly and by 1965 one could manage to finish only as high as fifth, the last appearance at Indianapolis coming in 1968 when Jim Hurtubise’s Mallard retired after nine laps with a dropped piston (something as serious as it sounds).

1954 Jaguar XK120s: Roadster (open two-seater (OTS) in the UK and certain export markets; left) and Drop Head Coupé (DHC; right).  The roadsters were lighter and intended as dual-purpose vehicles which could be road-registered, driven to circuits and with relatively few changes be immediately competitive in racing.  The DHCs were based on the heavier, more luxuriously trimmed Fixed Head Coupé (FHC) coachwork while the roadsters featured cutaway doors without external handles or side windows and a removable windscreen.  Variations on this pre-war pattern was common in the British and parts of the European industry; even the early Chevrolet Corvettes were true roadsters.  

In pre-war Europe (though less so in the UK where “sports-car” or “open two seater” tended to be preferred), roadsters were often those with most rakish or flamboyant bodies, offered either by the factory or outside coachbuilders.  After the war, the term came to be restricted to what were once known as sports cars, the smaller, lighter and most overtly sporty of the line.  British manufacturers also distinguished, within a line of convertible two-seaters between lightweight roadsters and the more lavishly equipped drop-head coupés (DHC) which had features such a full-doors and side windows, neither always fitted to roadsters.  Interestingly, the early Jaguar XK120s and 140s (1949-1957) were marketed as open two-seaters (OTS) in UK and roadsters in the US, the home market not adopting the export nomenclature until the XK150 in 1958.

300 SL gullwing (1954-1957)

Although the public found them glamorous, the engineers at Mercedes-Benz had never been enamored by the 300 SL’s gullwing doors, regarding them a necessary compromise imposed by the high side-structure of the spaceframe which supported the body.  Indeed, the doors had never been intended for use on road-cars, appearing first on the original (W194) 300SL, ten of which were built to contest sports-car racing in 1952.  The W194 had a good season, the most famous victory a 1-2 finish in the 24 Heures du Mans (24 Hours of Le Mans) and this success, along with the exotic lines, attracted the interest of the factory’s US importer who guaranteed the sale of a thousand coupés, essentially underwriting the profitability of full-scale road-car production.  The sales predictions proved accurate and between 1954-1957, 1400 (W198) 300 SL gullwings were built, some eighty percent of which were delivered to North American buyers.  Curiously, at the time, Mercedes-Benz never publicly disclosed what the abbreviation "SL" stood for.  The assumption had long been it meant Sport Light (Sport Leicht), based presumably on the SSKL of 1929-1931 (Super Sport Kurz (short) Leicht) but the factory documentation for decades used both Sport Leicht and Super Leicht.  It was only in 2017 it published a 1952 paper discovered in the corporate archive confirming the correct name is Super Leicht.

300 SL Roadster (1957-1963)
 
That the sales reached the numbers hoped was good because the gullwing was expensive to produce and a certain volume was required to achieve profitability but by 1956, sales were falling.  At that time the US distributer was suggesting there was greater demand for a convertible so the decision was taken to replace the gullwing with a roadster, production of which began in 1957, lasting until 1963 by which time 1858 had been built.  Now with conventional front-hinged doors made possible by a re-design of the tubular frame, the opportunity was taken also to include some improvements, most notably a more powerful engine and the incorporation of low-pivot swing axles in the rear suspension.  The rear axle changes, lowering the pivot-point to 87mm (3.4 inches) below the differential centre-line did reduce the camber changes which could be extreme if cornering was undertaken in an inexpert manner but the tendency was never entirely overcome.  The swing axles, much criticized in later years, need to be understood in the context of their times, the tyres of the 1950s offering nothing like the grip of more modern rubber although it is remains regrettable the factory didn't, for its high-performance road cars, adopt the de Dion rear suspension it used on both road and competition cars during the 1930s.  Although manageable in expert hands, as the Mercedes-Benz Formula One drivers in 1954-1955 proved, the more predictable de Dion would likely have been better suited to most drivers on the roads.  In fairness, the gullwing’s rear suspension did behave better than many of the more primitive swing-axle systems used by other manufacturers but it needed to given that in any given situation, the Mercedes would likely be travelling a deal faster.  Remarkably, the Mercedes-Benz swing-axle arrangement lasted well into the age of the radial-ply tyre, in volume production until 1972 and used until 1981 on the handful of 600 Grossers built every year.

300 SLS (1957)

Less costly to build than the gullwing, a few hundred 300 SL roadsters were sold annually, the price tag reaching even higher in the stratospheric realm.  Unlike the lighter gullwing, the emphasis shifted from a dual-purpose vehicle suited to both road and track to one that was more of a grand-tourer.  The factory however managed to give the car one last fling at competition.  The SCCA (Sports Car Club of America), tired of the gullwing’s domination in the production sports car category, changed the rules to render it uncompetitive and, as the new roadster hadn’t yet achieved the volume needed to qualify for homologation, Mercedes-Benz built a new model: called the 300 SLS (Super Light Sport), two built to contest the SCCA’s modified production class.  Much lighter, slightly more powerful and with a few aerodynamic tweaks, the SLS won the trophy.

As a footnote (one to be noted only by the subset of word nerds who delight in the details of nomenclature), for decades, it was said by many, even normally reliable sources, that SL stood for sports Sports Leicht (sports light) and the history of the Mercedes-Benz alphabet soup was such that it could have gone either way (the SSKL (1929) was the Super Sports Kurz (short) Leicht (light) and from the 1950s on, for the SL, even the factory variously used Sports Leicht and Super Leicht.  It was only in 2017 it published a 1952 paper (unearthed from the corporate archive) confirming the correct abbreviation is Super Leicht.  Sports Leicht Rennsport (Sport Light Racing) seems to be used for the the SLRs because they were built as pure race cars, the W198 and later SLs being road cars but there are references also to Super Leicht Rennsport.  By implication, that would suggest the original 300SL (the 1951 W194) should have been a Sport Leicht because it was built only for competition but given the relevant document dates from 1952, it must have been a reference to the W194 which is thus also a Sport Leicht.  Further to muddy the waters, in 1957 the two lightweight cars based on the new 300 SL Roadster (1957-1963) for use in US road racing were (at the time) designated 300 SLS (Sports Leicht Sport), the occasional reference (in translation) as "Sports Light Special" not supported by any evidence.  The best quirk of the SLS tale however is the machine which inspired the model was a one-off race-car built by Californian coachbuilder ("body-man" in the vernacular of the West Coast hot rod community) Chuck Porter (1915-1982).  Porter's SLS was built on the space-fame of a wrecked 300 SL gullwing (purchased for a reputed US$500) and followed the lines of the 300 SLR roadsters as closely as the W198 frame (taller than that of the W196S) allowed.  Although it was never an "official" designation, Porter referred to his creation as SL-S, the appended "S" standing for "scrap". 

Job done, the factory withdrew from circuit racing although private teams would continue to campaign 300 SLs into the 1970s.  The road-going version continued with little visual change until 1963 although the engineering refinements continued as running changes, disk brakes adopted in 1961, the last few dozen built with a lighter aluminum engine block replacing the cast-iron casting.  When retired, it wasn’t replaced, the W113 (pagoda) and their successors (R107) roadsters a different interpretation of the genre.  It would be decades before Mercedes-Benz would again offer anything like the 300 SL.

190 SL (1955-1963)

The reception afforded the 300 SL prompted the US distributor to suggest a lower cost sports car would also be well-received.  The economics of that dictated the exotic features of the gullwing (dry-sump lubrication, the doors, fuel-injection) couldn’t be used so the factory instead grafted attractive roadster coachwork atop a shortened saloon car platform, the pedestrian four-cylinder engine barely more powerful than when found in its prosaic donor.  Still, the 190 SL (W121) looked the part and could be sold for well under half the price of a gullwing though even then it was hardly cheap, costing a third more than a Chevrolet Corvette and by then the Corvette had been transformed into a most estimable roadster with the addition of the new Chevrolet 265 cubic inch (4.3 litre) small-block V8.  Pleasingly profitable, nearly twenty-six thousand 190 SLs were built over an eight-year run beginning in 1955 and there were even plans for a 220 SL, using the 2.2 litre (134 cubic inch) straight-six from the “pontoon” saloon range (W120-121-105-128-180; 1953-1963) which had provided the roadster's platform.  Prototypes were built and testing confirmed they were production-ready but the continuing success of the 190 SL and capacity constraints first postponed and finally doomed the project.  After production ceased in 1962 (none were built in 1963 but the factory listed the final 104 cars as 1963 models), it wouldn’t be until the 1990s that the concept of a smaller roadster (the R170 SLK) to run alongside the (R129) SL was revived although, since the early 1970s, the SL (R107) had simultaneously been available with engines of different sizes and accordingly placed price-points.


190 SL Rennsport, Macau Grand Prix, 1957.

Though never designed with competition in mind, the factory did construct half a dozen higher-performance Rennsport (motor-racing) packages (referred to internally as the 190 SLR), the most important aspect of which was diet, the weight-reduction achieved with aluminium doors, a smaller Perspex windscreen and the deletion of non-essential items such as the soft top, sound insulation, the heater (they're surprisingly weighty devices) and bumpers.  Although never part of a major racing campaign, it did enjoy success including a class win in a sports car event at Morocco and victory in the 1957 Macau Grand Prix.

Last of the Adenauers: 300d (W189, 1957-1962) Cabriolet D (upper) & the "standard" 300d saloon (four-door hardtop).

Although some of its customers during the mid-twentieth-century (notably between 1933-1945) are understandably neglected in their otherwise comprehensive attention to history, Mercedes-Benz has always acknowledged and publicized the drivers and clients of the 1950s.  Their Formula One drivers (especially Juan Manuel Fangio (1911–1995) & Stirling Moss (1929–2020) were honored for decades after their retirements and Konrad Adenauer, the first chancellor of the Federal Republic, was even afforded the unique distinction of being the nickname for the 300 (W186 & W189, 1951-1962), the big limousine of the era which used a substantially similar engine to the 300 SL's unit.  Note that although the top image is of a convertible, it's a "cabriolet" and not a roadster.  According to Mercedes-Benz, a roadster is a two door, two seater convertible although, since the 1960s, the factory has sometimes offered the option of single (transverse) or conventional rear seat for occasional (and sometimes uncomfortable) use.  Small, these seats were really suitable only for very young children and no pretence was made that they make a roadster into a true four-seater, 2+2 the usual (generous) description.  Being Germans, during the 1930s, Daimler-Benz decided there were sufficient detail differences between the coachwork and hood (in the sense of folding roof) assemblies offered and formalized definitions of five distinct flavors of Mercedes-Benz cabriolets.

Fraulein Rosemarie Nitribitt with 190 SL and Joe der Hund.

However, in a fate shared with some of the most valued clients of the three-pointed star between 1933-1945, nor does the factory’s historic literature dwell on someone perhaps the 190SL’s best known owners, Rosemarie Nitribitt (1933-1957).  Fraulein Nitribitt was, by 1957, Frankfurt’s most illustrious (and reputedly most expensive) prostitute, a profession to which she seems to have been drawn by necessity but at which she proved more than proficient and, as the reports of the time attest, there was nothing furtive in the way she practiced her trade.  Something of a celebrity in Frankfurt, the republic’s financial centre, her black roadster became so associated with her business model that the 190SL was at the time often referred to as the “Nitribitt-Mercedes”, her car seen frequently, if briefly, parked in the forecourts of the city’s better hotels.  Unlike the contemporary connection with Herr Adenauer, the factory never acknowledged this nickname.

190 SL sales breakdown

The lives of prostitutes, even the more highly priced, can descend to their conclusion along a Hobbesian path and in 1957, aged twenty-four, she was murdered in her smart apartment, strangled with a silk stocking, the body not found for several days.  Given Fraulein Nitribitt operated at the upper end of the market, her clients tended variously to be rich, famous & powerful and that attracted the raft of inevitable conspiracy theories there had been a cover-up to protect their interests, a rather botched police investigation encouraging such rumors.  The murder remains unsolved.  It has been suggested sales of the 190 SL suffered because of the connection, the little roadster briefly attracting the moniker “whore’s taxi” and indeed, there was a decline in the period.  However, 1956 was the first year of full-production and a second-year drop-off in sales is not unknown, gullwing production for example dropped to 308 in 1956, quite a fall from the 855 achieved the previous year and while, at least in Germany, the association with the dead courtesan may have been off-putting for the bourgeoise, without qualitative data, one really can’t say.  There was a precipitous decline in 1958 but that was the year of the worst US recession of the post-war boom and it was in the US most of the drop was booked; sales anyway quickly recovered on both sides of the Atlantic.

Frankfurt police officers examining Helga Matura's 220 SE cabriolet (Hōchkühler).  Note the jackboots.

In a coincidence of circumstances, a decade later, Fraulein Helga Sofie Matura (1933-1966) was another high-end prostitute murdered in Frankfurt, the weapon this time a stiletto (the stylish shoe rather than the slender blade).  Never subject to the same rumors the Nitribtt case attracted, it too remains unsolved.  In another coincidence, Fraulein Matura’s car was a convertible Mercedes, a white (W111) 220 SE Cabriolet.  Despite the connection, the W111 never picked up any prurient nicknames and nor did its reputation suffer, the most valuable of the W111 cabriolets now attracting prices in excess of US$400,000 for original or fully-restored examples while German turning houses which update the drive-trains to modern standards list them at twice that.

Helga Matura (1966) by Gerhard Richter

Gerhard Richter (b 1932) is a German visual artist whose work encompasses glass as well as aspects of both photography and painting.  Although most noted for working in illusionistic space, some of his output has belonged to various schools of realism and he seems to place himself in many of the traditions of modernism, acknowledging surrealism, the primacy of the object and the purpose of art.  Of particular interest was his 1988 series of fifteen photo-paintings (18 October 1977) depicting four members of the Red Army Faction (RAF) (better, if a little misleadingly, known in the English-speaking world as the Baader-Meinhof Gang).  Created using monochrome photographs taken mostly before their deaths, the work was an interesting exploration of time, meaning and form.

His portrait of the late Helga Matura is representative of his technique in photo-paintings, applying the practices of the Fluxus movement to material not originally created as art.  Blurred and variously in and out of focus, it takes the entirely representational image of a photograph which is then disrupted; disruptions may be for the purposes of the artist, the subject or the viewer and indeed time, the nature of the work changing whether viewed with or without knowledge of her life and death.

Roadster off the road, California, 2005.

In October 2005, Lindsay Lohan went for a drive in her Mercedes-Benz SL 65 AMG roadster.  It didn’t end well.  Based on the R230 (2001-2011) platform, the SL 65 AMG was produced between 2004-2012, all versions rated in excess of 600 horsepower, something perhaps not a wise choice for someone with no background handling such machinery though it could have been worse, the factory building 400 (175 for the US market, 225 for the RoW (rest of the world)) of the even more powerful SL 65 Black Series, the third occasion an SL was offered without a soft-top and the second time one had been configured with a permanent fixed-roof.  A production number of 350 is sometimes quoted but those maintaining registers insist it was 400.

Roadster back on the road, Texas, 2007.

By 2007, the car (still with California registration plates (5LZF057) attached) had been repaired, detailed & simonized and was being offered for sale in Texas, the odometer said to read 6207 miles (9989 km).  Bidding was said to be “healthy” so it was thought all's well that ends well but once the vehicle's provenance was brought to the attention of the repair shop, it was realized the celebrity connection might increase its value so it was advertised on eBay with more detail, including the inevitable click-bait of LiLo photographs.  However, either eBay doesn't approve of commerce profiting from the vicissitudes suffered by Hollywood starlets or they'd received a C&D (cease & desist) letter from someone's lawyers and the auction ended prematurely.  It proved a brief respite, the SL 65 soon back on eBay Motors but with the offending part of the blurb limited to "previously owned by high profile celebrity", leaving it to prospective buyers to join the dots.  According to Business Insider, the car sold for US$111,000 which was much higher than would be expected for one which had been repaired after an accident, albeit it a low-speed impact.  The R230s anyway had a complex construction and the AMG versions added even more intricacy so although it is possible to restore a damaged AMG to the state in which it left the factory, it does require both expertise and some often expensive parts.  Because of that, repaired Mercedes-Benz AMG cars trade usually at a significant discount so the amount realized was indicative of the perceived value of a celebrity association.