Showing posts sorted by date for query Lilo. Sort by relevance Show all posts
Showing posts sorted by date for query Lilo. Sort by relevance Show all posts

Thursday, March 13, 2025

Embezzle

Embezzle (pronounced em-bez-uhl)

In law, fraudulently to appropriate or convert (money or property entrusted to one's care) for one's own use (applied especially to fraud committed by an employee).

1375–1425: From the late Middle English embesilen, from the fourteenth century Anglo-French embesiler, embesillier & embeseillier (to destroy, make away with; to steal, cause to disappear), the construct being em- + beseiller, from the Old French beseiller (to torment, destroy, gouge) of uncertain origin.  The sense of “dispose of fraudulently to one's own use” dates from the 1580s.  The earliest known use of the noun embezzler (one who embezzles) was in the 1660s but it may pre-date that because the noun embezzlement was known in the 1540s while the noun embezzling dates from the early fifteenth century.  The em- prefix (used before certain consonants, most often the labials b and p) was a variant of the Middle English en-.  It was originally from the Old French en- (and an-), from the Latin in- (in, into) but was also from an alteration of in-, from the Middle English in-, from the Old English in- (in, into), from the Proto-Germanic in (in).  Both the Latin and Germanic forms were from the primitive Indo-European en (in, into).  The intensive use of the Old French en- & an- is due to confluence with the Frankish an- (the intensive prefix), related to Old English intensive prefix on-.  It was used to impart the sense of (1) in, into, (2) on, onto, (3) covered, (4) caused or (5) as an intensifier.  Embezzle, embezzles, embezzled & embezzling are verbs and embezzlement & embezzler are nouns; the most common noun plural is embezzler. 

In English law, embezzle was a special class of theft or fraud which was distinguished by two characteristics: (1) the act was committed by a person employed by the owner of the misappropriated property and (2) the property misappropriated was in the (legal) possession of the employee.  The fine distinctions arose early in the development of common law because of the practical difficulties caused by the long-established legal doctrine that to constitute a larceny, the property must be removed from the possession of the owner.  Servants and others were thus able to steal with impunity goods entrusted to them by their masters and a stature of 1529 was enacted, providing that it would be a felony were employees to convert to their own use jewels, money, goods or chattels delivered to them by their employers (masters in the terminology of the time).  It's an illustration of the difference between "in legal possession of" and "lawfully possessing".   

On the way out: Bernard Madoff leaving Manhattan Federal Court, Tuesday, 10 March 2009.

Confessed embezzler Bernie Madoff (1938-2021) embezzled almost US$20 billion using as a platform history's largest (known) Ponzi scheme.  After being arrested, the DoJ (Department of Justice) and the SEC (Securities & Exchange Commission) stated referring to him as “Bernard Madoff”, the media and most politicians following their lead; it was felt an affectionate diminutive like “Bernie” was no longer appropriate.  Between 1990-1993, during his respectable period, Mr Madoff served three one-year terms as chairman of the National Association of Securities Dealers Automated Quotations (the Nasdaq (one of those initialisms which became an acronym)); the New York-based stock exchange described usually as "tech heavy").  Even today, Mr Madoff's scheme is sometimes described as "a US65 billion scam" but the actual embezzlement was around US$20 billion, the additional funds all in his imagination.  Predictably, those who did best were the lawyers involved in the case who charged a reputed US$800 million.  

The idea that “theft as a servant” was an offense which deserved a greater punishment that theft by a stranger remains a doctrine in common law jurisdictions, the rationale being that such crime is also a violation of trust.  In Australia, the concept has attracted interest of late because of the increasing frequency of “wage-theft” cases in which employers have been found to have been engaged in deliberately under-paying their staff, sometimes in a manner which is so carefully constructed as to have been held to have been systemic.  In most jurisdictions, the penalties available remain civil but two states have recently passed laws permitting criminal prosecutions of both corporations and individuals.  Legal commentators have generally welcomed the development, noting the frequently cited defense that organizations lacked the resources to deal with the complexity of the award wage system didn’t appear to constrain them when engaging in the tax minimization exercises made possible by the intricacies of tax law.  The law reform does nothing to alter the notion of “theft as a servant” being higher order of offending that done by a stranger but it does slightly redress the injustice of embezzlement by employees being by definition a criminal act yet embezzlement by employers was only ever a matter redressed by civil action and, in a practical sense, usually claimed to be “an error” rather than a “deliberate act”, a defense rarely tolerated if raised by an employee (an in this judges were doubtlessly usually correct).  The first case under a criminal code is now before the Victorian courts.

In idiomatic use, someone with their “fingers in the till” is committing embezzlement.  Synonyms exist but because of precise definitions in law, not all are interchangeable in a legal context.  In general use they include filch, loot, misappropriate, misuse, pilfer, purloin, skim, abstract, defalcate, forge, misapply, peculate, thieve, defalcate, flog, pinch and peculate.  Most tempting because of the rarity is probably the verb peculate (embezzle, pilfer, appropriate to one's own use public money or goods entrusted to one's care) from 1749, from the Latin peculatus, past participle of peculari (to embezzle), from peculum (private property (and originally "cattle"), the related forms being peculated, peculating & peculator.

The Great Crash 1929

The Great Crash 1929 (1955) by JK Galbraith.

Bezzle was a back-formation from embezzle, coined by the economist JK (Ken) Galbraith (1908-2006) in his 1955 book The Great Crash, 1929.  In the technical language of economics, bezzle is the temporary gap between the perceived value of a portfolio of assets and its long-term economic value.  The actions and forces which operate in economies over time create bezzle which unleash consequences understood usually only in retrospect.  The significance of the derivation from embezzlement was that Galbraith called it “the most interesting of crimes”, noting: Alone among the various forms of larceny [embezzlement] has a time parameter. Weeks, months or years may elapse between the commission of the crime and its discovery. (This is a period, incidentally, when the embezzler has his gain and the man who has been embezzled, oddly enough, feels no loss. There is a net increase in psychic wealth.) At any given time there exists an inventory of undiscovered embezzlement in—or more precisely not in—the country’s business and banks.

The conditions which exist at certain times Galbraith observed, are especially conducive to the creation of bezzle, and “…at particular times this inflated sense of value is more likely to be unleashed, giving it a systematic quality”.  Those times tend to be defined by the business cycle in that “…in good times, people are relaxed, trusting, and money is plentiful.  But even though money is plentiful, there are always many people who need more.  Under these circumstances, the rate of embezzlement grows, the rate of discovery falls off, and the bezzle increases rapidly. In depression, all this is reversed.  Money is watched with a narrow, suspicious eye. The man who handles it is assumed to be dishonest until he proves himself otherwise. Audits are penetrating and meticulous.  Commercial morality is enormously improved and the bezzle shrinks."

The Great Crash 2005

Crashed and towed, Los Angeles, 2005.

In October 2005, Lindsay Lohan went for a drive in her Mercedes-Benz SL 65 AMG roadster.  It didn’t end well.  Based on the R230 (2001-2011) platform, the SL 65 AMG was produced between 2004-2012, all versions rated in excess of 600 horsepower, something perhaps not a wise choice for someone with no background handling such machinery though it could have been worse, the factory building 400 (175 for the US market, 225 for the RoW (rest of the world)) of the even more powerful SL 65 Black Series, the third occasion an SL was offered without a soft-top and the second time one had been configured with a permanent fixed-roof.  A production number of 350 is sometimes quoted but those maintaining registers insist it was 400.

Fixed and simonized, Texas, 2007.

By 2007, the car (still with California registration plates (5LZF057) attached) had been repaired, detailed & simonized and was being offered for sale in Texas, the odometer said to read 6207 miles (9989 km).  Bidding was said to be “healthy” so it was thought all's well that ends well but once the vehicle's provenance was brought to the attention of the repair shop, it was realized the celebrity connection might increase its value so it was advertised on eBay with more detail, including the inevitable click-bait of LiLo photographs.  However, either eBay doesn't approve of commerce profiting from the vicissitudes suffered by Hollywood starlets or they'd received a C&D (cease & desist) letter from someone's lawyers and the auction ended prematurely.  It proved a brief respite, the SL 65 soon back on eBay Motors but with the offending part of the blurb limited to "previously owned by high profile celebrity", leaving it to prospective buyers to join the dots.

Jacqueline Kennedy (1929-1994; US First Lady 1961-1963) with the elongated Ken Galbraith who at the time was serving as US ambassador to India.  Galbraith later recalled how difficult it was to get John Kennedy (JFK, 1917–1963; US president 1961-1963) interested in subjects like agriculture, a matter then (as now) of great matter in the Indian economy.

In other words, there can exist a temporary (and not necessarily short) difference between the actual economic value of a portfolio of assets and its reported market value, especially during periods of irrational exuberance.  At these times, there is “…a net increase in psychic wealth” because (1) the embezzler both feels and is richer while the original owners of the portfolio do not realize that they are poorer.  The classic case studies of the phenomenon are those duped in Ponzi schemes, a mechanism of deception in that two people simultaneously can enjoy the same wealth but the effect is similar when accounting fraud is involved, companies like Enron and WorldCom booking overvalued assets and excessively high stock valuations.   Until accounting frauds are uncovered, there is a collective increase in psychic wealth as the value of the bezzle rises.  Bezzle is of course temporary and when the truth emerges perceived wealth decreases until it once again approximates real wealth but this is not an abstract measure of value, the perceptions greatly influencing patterns of consumption with obvious effects upon the real economy.  Many recessions have followed the unwinding of a bezzle and of course, Galbraith’s 1955 book was about the worst of them, the Great Depression of 1929.

Others have since refined the idea of bezzle, noted investor Charles Munger (b 1924) explaining the net effect of a bezzle doesn’t actually demand that there be some form of constructive embezzlement as described by Galbraith.  It needs only that when the reported market value of an asset or portfolio temporarily exceeds its real economic value (which he defined as the value of future returns on that asset), the economy goes through the same cycle of increase and decrease in psychic wealth.  Munger tracked the way rising asset prices, disconnected from their underlying long-term economic value, can contribute to what he called the febezzle.  The word didn’t linger in the language as bezzle has but his insight certainly has, his point being that rising stock or real estate prices can generate income and wealth effects whether or not these rising prices reflect real increases in the earning capacity of these assets.  When asset prices rise for reasons other an increases in actual productive capacity, the overall economy doesn’t benefit because there will be no corresponding increase in the productive capacity of that economy.  The owners of the over-valued assets so of course feel richer but only temporarily because prices eventually converge to a value that represents their real contribution to the production of goods and services, thus the concern some express during periods of irrational exuberance in markets such as fashionable equities, real estate, cryptocurrencies or tulip bulbs.

Interestingly, Munger was discussing things in the distant world of the 1990s when commentators were expressing concern about the economic pattern in Western economies simultaneously to drive up asset prices while restricting the money supply.  Some of the range of possible consequences of that had unfolded since the early 1980s but those events provided little guidance to what might happen were the same forces to be unleashed when the money supply was allowed rapidly to expand and sold at marginal cost.  In the twenty-first century, the successive reactions of central banks to (1) the “tech wreck” of 2000-2001, (2) the global financial crisis (2008-2011) and (3) the COVID-19 pandemic mean the implications can be explored.

The photograph used on the cover of some editions of Galbraith's book was one of two staged on 30 October 1929 (shortly after the "Wall Street crash") which purported to show investor Walter Clarence Thornton (1903–1990) offering to sell his 1928 Chrysler Imperial 75 Roadster for US$100, a new one at the time typically costing between US$1550-2000 depending on the configuration.  The Imperial name was used by Chrysler for its upper range models between 1926-1954 after which it was the corporation's stand-alone marque designed to compete with Cadillac, Lincoln and Packard, an approach abandoned in 1975 and few care to recall the abortive revival of 1990-1993.  At this time, Mr Thornton was working as a model and the "lost all on the stock market shoot" was just another gig.  He's remembered also for founding the Walter Thornton Modeling Agency which would be one of the most successful in the industry until the mid-1950s when he was the victim of a malicious prosecution.  All charges were dropped before going to court but so much was his reputation damaged by "trial-by-tabloid" he retired to Mexico.

Thursday, January 12, 2023

Simonize

Simonize (pronounced sahy-muh-nahyz)

(1) To polish the exposed surfaces of an automobile (specifically using Simoniz brand products; later used generically).

(2) To shine or polish something to a high sheen, especially with wax.

Circa 1921: A creation of US English meaning "polish by the application of Simoniz wax”, from Simoniz, the registered trademark for a brand of car polish invented by George Simons who in association with Elmer Rich of the Great Northern Railway, in 1910 formed the Simons Manufacturing Company (Chicago) to produce and sell the products.  The construct was Simoniz + “e”, the addition an emulation of the –ize prefix  Said to have been in oral use since circa 1921, lexicographers began to add simonize (as a verb with the noted meaning) to dictionaries in 1935.   In the English-speaking world, the word often appeared (outside North America) as simonise.  Simonize, simonizes, simonized & simonizing are verbs.

The –ize suffix was from the Middle English -isen, from the Middle French -iser, from the Medieval Latin -izō, from the Ancient Greek -ίζω (-ízō), from the primitive Indo-European verbal suffix -idyé-.  It was cognate with other verbal suffixes including the Gothic -itjan, the Old High German –izzen and the Old English -ettan (verbal suffix).  It was used to form verbs from nouns or adjectives which (1) make what is denoted by the noun or adjective & (2) do what is denoted by the noun or adjective.  The alternative form is –ise.  Historically, the –ize suffix was used on words originating from Greek while –ise was preferred (most prevalently as -vise, -tise, -cise and –prise) on words derived from various roots, many of which entered English via French.  In the nineteenth century, under the influence of French literature, in the UK and other parts of the British Empire, -ise often replaced –ize even when there was a long tradition of the latter’s use.  The authoritative Oxford English Dictionary (OED) never changed its spellings which meant that throughout the Empire (and later the Commonwealth), both forms appeared and before the advent of spell-checkers (which ensured that at least within a given document there was consistency) use was mixed although, under the Raj and beyond, India tended to stick to –ise.  The –ize has always been the preferred form in North America.

Spa day service station, Connecticut Avenue. Washington DC, September 1940.

Although simonize had by then entered the language as verb meaning “to shine or polish something to a high sheen, especially with wax”, one of the early conditions imposed to permit the advertising of “Simonizing” as a service was the exclusive use of genuine Simoniz brand products.

One reason companies registered trademarks used to be a wish to control the use of the name, businesses wishing to prevent their exclusive brand becoming so popular it came to be used to describe, and to some extent even define, all similar products.  The process was called genericide by the experts in business and marketing, the idea being that in becoming a generic term, some of the value invested in the product and its name was transferred to competitors.  The classic example was the vacuum cleaner made by Hoover, the word catching on to the extent that within years, just about all vacuuming came to be called “hoovering”, regardless of the manufacturer of the device doing the sucking.  The problem was that while trademark holders could restrict their use by corporations, what the public did was beyond their control and language just evolved by popular use.

The early Xerox photocopiers were always advertised as devices to be used by women.

The literature often cites Xerox as an example of the problem of the public perception of a corporation being defined in their imagination by its best known product.  The phrase “xerox it” had by the late 1960s become the default expression meaning “photocopy it” and was of concern to the corporation because they feared their differentiation in the market place would be lost.  Time however change and now, Microsoft would doubtless be delighted if “bing it” became as much a term of everyday speech as “google it”.  That is of course a little different because “Bing” is one of Microsoft’s many trademarks rather than the corporate name but the modern view now generally is that the public “verbing-up” a trademark is a very good thing and an easy way to extend the prized “brand awareness”.

The perfect secretary did much "xeroxing" but according to Xerox, would never say "xerox it".

Twitter’s case is a variation on the theme and a case study on how such matters must be managed.  The verb form “to tweet” became a verb through popular use which induced Twitter to trademark the term in 2009.  From there, the company announced they would not seek to restrict its use by third parties using “tweet” for Twitter-related services and apps but warned they would seek both injunctive relief and damages were there evidence of a “confusing or damaging project” to “to protect both our users our brand."  What Twitter wanted to do was ensure “tweet” was used in a way beneficial and not detrimental to them.

The Great Crash of 2005

Crashed and towed, Los Angeles, 2005.

In October 2005, Lindsay Lohan went for a drive in her Mercedes-Benz SL 65 AMG roadster.  It didn’t end well.  Based on the R230 (2001-2011) platform, the SL 65 AMG was produced between 2004-2012, all versions rated in excess of 600 horsepower, something perhaps not a wise choice for someone with no background handling such machinery though it could have been worse, the factory building 400 (175 for the US market, 225 for the RoW (rest of the world)) of the even more powerful SL 65 Black Series, the third occasion an SL was offered without a soft-top and the second time one had been configured with a permanent fixed-roof.  A production number of 350 is sometimes quoted but those maintaining registers insist it was 400.

Fixed and simonized, Texas, 2007.

By 2007, the car (still with California registration plates (5LZF057) attached) had been repaired, detailed & simonized and was being offered for sale in Texas, the odometer said to read 6207 miles (9989 km).  Bidding was said to be “healthy” so it was thought all's well that ends well but once the vehicle's provenance was brought to the attention of the repair shop, it was realized the celebrity connection might increase its value so it was advertised on eBay with more detail, including the inevitable click-bait of LiLo photographs.  However, either eBay doesn't approve of commerce profiting from the vicissitudes suffered by Hollywood starlets or they'd received a C&D (cease & desist) letter from someone's lawyers and the auction ended prematurely.  It proved a brief respite, the SL 65 soon back on eBay Motors but with the offending part of the blurb limited to "previously owned by high profile celebrity", leaving it to prospective buyers to join the dots.

Sunday, November 20, 2022

Lilo

Lilo (pronounced lahy-loh)

(1) The trademark for a type of inflatable plastic or rubber mattress, often used when in lakes, swimming pools etc.

(2) As a generic term, any inflatable mattress, especially those used recreationally in lakes, swimming pools etc).

(3) The portmanteau slang synonym for Li(ndsay) Lo(han); it was also applied as the name of a dance Ms Lohan performed ad-hoc on the Greek island of Mykonos in 2018.

(4) As LILO, the acronym for Li(nux) Lo(ader), an early (1991-2015) boot loader for the Linux operating system.

(5) As LILO, in computing, organizational management, accountancy and behavioral science, as the acronym for L(ast) I(n), L(ast) O(ut), a companion unit descriptor to FIFO (First In, First Out) & FILO (First in Last Out), all methods with which to organize the manipulation of data structures.  Under LILO, the last object in a queue is the last object to leave the queue.

1944: The trademark name Lilo (originally Li-Lo) registered by the company which made inflatable air-mattresses of rubberized canvas dates from the 1940s (1944 in the UK; 1947 in the US) and was a sensational spelling based on the phonetic “lie low”.  Lilo also exists in other languages: In the Philippines, in the Cebuano language a lilo is a swirling body of water or a large and violent whirlpool (a maelstrom) while in Tagalog it’s an adjective meaning disloyal; unfaithful; traitorous; treacherous (the synonyms being taksil, sukab, mapagkanulo & traydor).  In Hawaiian, Lilo is a feminine given name meaning “generous one” although in some traditions in the islands it can be translated as “lost” so the song He Mele No Lilo translates (loosely) as “Lullaby of the Lost”.  Lilo is a noun, the noun plural is lilos.

The Li-Lo Kayak, 1960.  The car depicted is a stylized rendition of an early version of one from the Rootes Group's "Audax" range (1956–1967).

The technology of the lilo was adaptable and able to assume various shapes, the LiLo company dabbling in a number of market niches including furniture, packaging and inflatable canoes.  The Kayak however was complex in construction so its production was thus labor intensive so it never sold in the numbers required to achieve the economies of scale which could have lowered the price and at Stg£25 (over Stg£500 in 2022 values) it was too expensive to succeed.  The idea has however been revived in the twenty-first century and "lilo & inflatable kayak" adventure tourism is now a thing.

The Bravissimo Lilo

The joke which buyers took seriously: the Bravissimo Lilo.

Bravissimo's Lilo appeared originally in 2018 as an April Fools' prank but such was the demand it was put into production and is now Bravissimo part-number SW571, available exclusively in hot pink.  Although there have since the 1940s been improvements in materials (lilos are made usually from polyvinyl chloride (PVC) or textile-reinforced urethane plastic or rubber), the innovation on Bravissimo's is the first structural change in design in seventy-five years.  Integrating what the manufacturer calls “cup holders” the unique feature is a one-size-fits-all lacuna at the appropriate position so the breasts may comfortably rest un-squished when a woman is supine, lying face-down

Room to move: One size fits all.

Even Bravissimo, an underwear company which specializes in the niche of bigger boobs, admits they really should have thought of this before, given the discomfort suffered by lilo-using women tends to increase in direct proportion to cup-size.  It’s available in-store in some Bravissimo outlets and on-line at Stg£28 (US$45).

No longer one size fits all: Crash test dummies (CTD) now more inclusive.

Perhaps Bravissimo being nudged into making available a lilo which took account of women's unique anatomical differences inspired others because, some fifty years after they came into use, Swedish engineers have at last developed a crash-test dummy (CTD; "seat evaluation tool" the technical term) representative of the body of a typical woman.  Until now, almost all CTDs have been based on the build and weight of a typical adult male.  In most markets however, women however have long represented about half of all drivers and passengers yet the CTD manufacturers and regulators used in testing as a proxy for women was a scaled-down version of the male one, roughly the size of a typical girl of twelve and at 1.49m (4', 8") and weighing 48kg (106 lb), in accord with only the smallest 5% of women by the standards of the mid-1970s.  The new CTD is a more representative 1.62 m (5', 3") tall, weighing in at 62kg (137 lb) so it's another DEI (diversity, equity and inclusion) building block. 

The need for a range of CTD with characteristics covering most of the population was discussed in the 1960s when US regulators began to write the first standards for automotive safety but industry lobbyists did their work and ensured crash-testing would be done as cheaply as possible, hence the standard, one-size-fits-all male analogue.  Despite years of convincing research which confirmed women were disproportionately injured in crashes (height rather than weight apparently the critical variable in the interaction of their smaller frames with seat-belts and air-bags), it wasn't until 2011 that US federal regulators required manufacturers to use more petite CTDs in frontal automotive crash tests.  It's hoped the new, Swedish-developed CTD will improve outcomes and the data from physical testing will soon be available for use in the increasingly important computer emulations, a field in which artificial intelligence (AI) is proving useful.

Lindsay Lohan: Studies of Lilo lying low in three aspects.

Lindsay Lohan’s moniker LiLo is a blend, the construct being Li(ndsay) + Lo(han).  Being based on proper nouns, in linguistics this would by most be regarded a pure blend, although some would list it as a portmanteau which is a special type of blend in which parts of multiple words are combined into a new word (and some insist that in true portmanteaus there must be some relationship between the source words and the result).

Thursday, September 8, 2022

Terpsichore

Terpsichore (pronounced turp-sik-uh-ree)

(1) In Classical Mythology, the goddess of dancing and choral song and one of the nine Muses who were daughters of Zeus (god of sky and thunder) & Mnemosyne (the goddess of memory).

(2) In choreography; the art of dancing (should always be lowercase).

(3) In astronomy (as 81 Terpsichore), a main belt asteroid.

Circa 1760: From the Classical Latin Terpsichorē from the Ancient Greek Τερψιχόρη (Terpsikhórē) (literally “enjoyment of dance”), noun use of the feminine of terpsíchoros (delighting in the dance), the construct being τέρψις (térpsis; térpein) (to delight; enjoyment) + χορός (khorós) (dance; chorus); it’s from terpsíchoros that English gained chorus.  The Greek was térpein was from the primitive Indo-European root terp- (to satisfy) source also of Sanskrit trpyati (takes one's fill) and the Lithuanian tarpstu & tarpti (to thrive, prosper).

The adjective terpsichorean (pertaining to dancing (literally “of Terpsichore”)) dates from 1869, and was from the Latinized form of the Greek noun terpsikhore (Muse of dancing and dramatic chorus).  From this came the theatrical slang terp (stage dancer, chorus girl) noted since 1937.  The adjectival form terpsichorean often appears with an initial capital letter because of its etymology from a proper noun.  Either is acceptable but the conventions of Modern English tend eventually to prevail which suggests use of the capital T will reduce with time but, given the rarity of the word except in a few technical and historical disciplines, the classic form is likely to endure among those few who enjoy its use.

In the mythology of Ancient Greece, nine goddesses ruled over art and literature.  The Greeks called them Muses and the Muse of dance and choral music was Terpsichore.  Of late she’s been of interest to astronomers who adopted her as a metaphor for the rhythm and ordered movement in the universe, such as mechanical oscillations.  In Archaic Greece, there were but three Muses, all associated with song and dance; it was only in the classical period they became nine and assigned to distinct spheres: Calliope of epic poetry, Clio of history, Euterpe of lyric poetry, Erato of love poetry, Melpomene of tragedy, Polyhymnia of hymns, Thalia of comedy, Urania of astronomy, and Terpsichore of dance and choral music.  The daughters of Zeus and Mnemosyne, they dwelt in the land of Pieria in the foothills of Mount Olympus.  In later mythology, writers tended to compare the Muses to the sirens but while both were young nymphs famous for their beautiful songs, the Muses sang to enrich men’s souls while the sirens were chthonic and sang to lure them to their deaths.

The Greek historian Herodotus (circa 484-425 BC) wrote his στορίαι (historíai̯; in the West styled variously as The History or The Histories of Herodotus)) as an account of the Greco-Persian Wars (499-449 BC).  Although there was once some doubt about the veracity as a historical document (reflecting more the scepticism about medieval editors and translators than the original texts), modern research has concluded the work is one of the most reliable histories from antiquity.  Herodotus was called “The Father of History” by the Roman orator Cicero (103-46 BC) because of the quality of his writing but he's also now acknowledged as the father of historiography's modern structural form.  Written histories had existed prior to Herodotus but he was the first to adopt a recognizably modern thematic form.  At some unknown time, one or more editors reorganized The History into nine chapters, each name after a Muse, one of which was Terpsichore:  Book I (Clio), Book II (Euterpe), Book III (Thalia), Book IIII (Melpomene), Book V (Terpsichore), Book VI (Erato), Book VII (Polymnia), Book VIII (Urania) & Book IX (Calliope).

The Muse Terpsichore In Ancient & Modern Greece.  Allegory of the Muse Terpsichore playing a harp, from the Florentine School of the eighteenth century, oil on canvas by an unknown artist (left) and Lindsay Lohan dancing The Lilo, Lohan Beach House, Mykonos, Greece, 2018 (right).

Despite the similarity, there’s no verified connection between khorós (dance; chorus) and χώρς (khrās), inflection of χώρ (kh) (location, place, spot; the proper place; one's place in life; piece of land: tract, land, field; country (as opposed to a city or town), countryside; country, nation.  The origin of khôra is unknown and it may be from a Pre-Greek substrate or other regional language although speculative links have been suggested including χ́ος (kháos) (empty space, abyss, chasm) and χατέω (khatéō) (to lack, miss, need, desire) but few etymologists have supported either and the lack of cognates beyond the Greek rendered research a dead end.  Khōra had been adopted as the ancient name for the land lying between the Tigris and Euphrates rivers north of Babylon (modern-day Iraq), from the Greek mesopotamia (khōra (literally "a country between two rivers)), from the feminine of mesopotamos, the construct being mesos (middle), from the primitive Indo-European root medhyo- (middle") + potamos (river).  That use borrowed directly from the discussions from Antiquity.

However, khôra did attract the interest of those scourges of late twentieth century linguistics: the French deconstructionists.  Their attention seems to have been excited by the concept of khôra in the sense of “the territory of the Ancient Greek polis which lay beyond the city proper”.  The philosophers of Antiquity, noting the idea of khôra simultaneously as (1) the physical space between city & the wilderness, (2) the time it takes to transverse the space and (3) one’s state of mind while in the space.  It was very much a concept of the indeterminate, a triton genos (third kind), being neither civilization nor the state of nature and city nor wilderness and few things so appealed to the deconstructionists as the indeterminate.

Of course, one attraction of deconstruction was that it was in itself a layer of indeterminacy and Jacques Derrida (1930-2004), post-modernism’s most famous explorer of khôra in the context of apophatism or negative theology, was interested not how the word had been understood in the traditions of metaphysics & metaphorics but what meaning could be constructed for something which is neither present or absent, passive or active.  The findings from khôra’s time on post-modernism’s autopsy table did illustrate why deconstruction gained a special role in language because there was surely no other way that Plato’s entirely cosmological concept could become psycho-linguistic and produce, in all seriousness, the idea of khôra as “container of the uncontainable”.  Plato (circa 425-circa 347 BC) had imagined khôra as that space through which something could pass but in which nothing could remain so thus to a French deconstructionist the very essence of tout autre (fully other) and from there it wasn’t very far to the idea of khôra also as time and space interacting.  At that point, in the tradition of post-modernism, khôra meant whatever the observer decided it meant.

The Terpsichore in Modern Greece: Lindsay Lohan dancing The Lilo, Lohan Beach House, Mykonos, Greece, 2018.


Tuesday, May 10, 2022

Portmanteau

Portmanteau (pronounced pawrt-man-toh)

(1) A case or bag to carry clothing in while traveling, made usually from stiff leather, hinged at the back so as to open out into two compartments

(2) A word created by blending two or more existing words.

1580s (for the travelling case (flexible traveling case or bag for clothes and other necessaries)): From the Middle French portemanteau (travelling bag, literally "(it) carries (the) cloak").  The original meaning from the 1540s was “court official who carried a prince's mantle" from porte, (imperative of porter (to carry) + manteau (cloak)).  The correct plural is portmanteaux but in modern English use, portmanteaus (following the conventions for constructing plurals in English) is now more common.  In the nineteenth century, the word was sometimes Englished as portmantle, a use long extinct.  The notion of the portmanteau word (word blending the sound of two different words) was coined by Lewis Carroll (pen-name of Charles L. Dodgson; 1832-1898) in 1871 for the constructions he invented for Alice Through the Looking-Glass such as Jabberwocky, his poem about the fabulous beast the Jabberwock.  Portmanteau in this sense has existed as a noun since 1872.

Vintage Louis Vuitton Portmanteau, typically circa US$50-80,000 depending on condition.

A portmanteau word, a linguistic blend, differs from contractions and compounds.  Contractions are formed from words that would otherwise appear together in sequence, such as do + not to make don't, whereas a portmanteau word is joins two or more words that relate to the one contractual theme.  A compound word is merely the joining for words in their original form (eg under + statement) without any truncation of the blended words.  Portmanteau words (eg breakfast & lunch to create brunch) always modifies at least one of the original stems.

Lindsay Lohan's handy moniker Lilo (the construct being Li(ndsay) + Lo(han) and it's used sometimes as LiLo) is a portmanteau word.

The word portmanteau was first used in this sense by Lewis Carroll in Alice Through the Looking-Glass (1871) where the concept is helpfully explained by Humpty Dumpty.  Less erudite but just as amusing was the creation of refudiate by Sarah Palin when she got confused and conflated refute and repudiate although it’s unclear whether she knew the meaning of either.  Even those created or used by more literate folk are not always accepted.  Irregardless (portmanteau of regardless and irrespective) seems to stir strong feelings of antipathy in pedants who generally won’t accept it even as a non-standard form and insist it’s simply wrong.  Other languages also create blended forms as needed.  The title of Emile Habibi’s 1974 novel was translated from Arabic utashaʔim (pessimist) + mutafaʔil (optimist) into English as The Pessoptimist.  Arabic linguistic traditions however prefer acronyms and compounds which sometimes overlap.  The group known variously as ISIL or ISIS (although they came to prefer "caliphate" or "Islamic State" (IS)) first adopted the name ad-Dawlah al-Islāmiyah fī 'l-ʿIrāq wa-sh-Shām (Islamic State if Iraq and the Levant) which is usually written as Daesh or Da'ish.  IS think this derogatory as it resembles the Arabic words daes (one who tramples underfoot) and dāhis (those who sows discord).  IS threatened to punish those who use Daesh or Da'ish with a public flogging; repeat offenders promised the cutting out of the tongue.

In the manufacture of big words, English is unlikely ever to match the Germans.  Until changes in EU regulations rendered it obsolete, the longest word in the Fourth Reich was rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz (law delegating beef label monitoring).  Currently, the longest word accepted by German dictionaries is kraftfahrzeughaftpflichtversicherung (automobile liability insurance), editors rejecting donaudampfschifffahrtsgesellschaftskapitaenswitwe (widow of a Danube steamboat company captain) because of rarity of use.

Saturday, July 24, 2021

Manhattan

Manhattan (pronounced man-hat-n or muhn-hat-n)

(1) An island in New York City (NYC) surrounded by the Hudson, East and Harlem rivers, 13½ miles (22 km) in length, 2½ miles (4 km) across at its widest and 22¼ square miles (58 km2 in area).  Technically, it’s an ellipsis of Manhattan Island and in certain legal documents, cartography and for formal purposes it’s described also as Manhattan Island.

(2) One of the five boroughs of New York City, approximately co-extensive with Manhattan Island and coterminous with New York County.  It contains the business district of NYC, its financial centre (Wall Street, the New York Stock Exchange (NYSE) etc and many of the businesses associated with the fashion industry (Fifth Avenue and environs) and the art business (Greenwich Village).

(3) A cocktail drink consisting of four parts whisky, one part vermouth, and a dash of bitters.

Pre 1600: From the earlier Manna-hata (recorded by Dutch settlers & military personnel), from its name in Unami, the Algonquian language of the Lenape people (self-described as Lenni-Lenape (the original people)) who were the island’s inhabitants when European settlement began.  The research by linguistic anthropologists was inconclusive and there are a number of suggestions regarding the origin of the name: (1) a compound of the Unami mënatay (island) or the Munsee munahan + another element; (2) because the island was once a wooded area with Hickory trees yielding timber suitable for making bows, the early forms Manna-hatta & Mannahachtink were spellings of manaháhtaan (place for gathering the wood to make bows) with the related locative form being manaháhteenk, the construct thus Munsee manah- (gather) + -aht (bow) + -aan (place); (3) the “island of many hills” & (4) “the island where we all became intoxicated”.  Manhattan is a noun & proper noun, manhattanite & manhattanese are adjectives, manhattanism is a noun, manhattanize manhattanizing & manhattanized are verbs and manhattanism & manhattanism are nouns; the noun plural is manhattans.  Modern style guides suggest that even when forms are derived from the proper noun, there’s no need for an initial capital although traditionalists will insist.

What is now New York’s borough of Manhattan was in 1626 named New Amsterdam by colonists from the Dutch Republic who, two years earlier, had established a trading post (in what is now Lower Manhattan).  After some of the squabbles and negotiations during which Europeans re-drew the maps which reflect their arrangements even today, the territory and its surroundings in 1664 came under English control in 1664 and the city, based on Manhattan, was the capital of the United States between 1785-1790.  Although the exact date on which “Manhattan” became the common descriptor for the island among Europeans, the consensus is it would have been sometime in the mid-seventeenth century.  The cocktail named Manhattan was certainly being served in the 1870s but why it gained the name or just when the first was mixed isn’t known although there are a number of imaginative tales, none supported by evidence.  What is thought most likely is that it was either served in an establishment in the locality or somewhere close seeking to trade of the association with the name.

Lilo in Soho: The Manhattan apartment where Lindsay Lohan lived in 2013, Mercer Street, Soho.

The standard adjective is Manhattanite (of or from, Manhattan) which replaced the earlier Manhattanese which, although obsolete, is sometime still used as a jocular term (to describe a certain style of speck thought associated with financial traders although it was a hardly distinct form).  The noun Manhattanism (the style of architecture and urban design associated with skyscrapers to enable high population densities in a limited space) was a coining of architectural criticism, the companion verbs being Manhattanize, Manhattanizing & Manhattanized; the process was Manhattanization.  In architectural criticism, Manhattanization was something neither wholly good or bad and depended for its reception on where it was used.  Where it was appropriate and added to urban utility, it would be praised if done well but where it destroyed something of social or architectural value, it was derided.

The Manhattan Project's second detonation of an atomic bomb: the mushroom cloud over Hiroshima, 6 August 1945.

The Manhattan Project which developed the first atomic weapons was so-named because the army component of the operation was under the control of the engineering branch and it was the army which was most involved in the initial planning stages which involved the acquisition of land and the physical building of the facilities which would house the research and production staff.  The army’s original project name was “Manhattan Engineer District” simply because that was where their offices were located and, apparently because the US Postal Service used the same name for the workshops of its telephone technicians, it was decided was “Manhattan Engineer District” would be a suitably vague codename and one unlikely to attract attention.  It thus replaced the earlier US A-bomb code name (Development of Substitute Materials) and absorbed the earlier British research project (Tube Alloys).

The Manhattan cocktail

Some cocktails are intimidating not because of what they are but because of what’s involved in their preparation, thus the attraction of the Manhattan cocktail which is easy-to-make drink and needs but three ingredients: whiskey, sweet Vermouth and aromatic bitters.

Ingredients

(1) 2 oz Whiskey: A Manhattan can be made with either Rye or Bourbon, most historically preferring Rye Whiskey because it’s thought to be “spicier”.

(2) 1 oz Sweet Vermouth: Vermouth has something of an aura because it’s vital to both Manhattans and Martinis but it’s just a flavored and fortified wine and it’s the harmonious interaction Rye and Sweet Vermouth which accounts for most choosing Rye.  The garnishing of a Manhattan with a brandied or Maraschino cherry is optional.

(3) 2 dashes Angostura aromatic bitters: A timeless classic and an aromatic, alcoholic infusions of various herbs and spices, neither the recipe or the distinctive oversized label have changed for well over a century.  One drop is so potent it can alter the character of anything to which it’s added and some even recommend a dash in fruit salad (the other faction advocating a few drops of Tabasco sauce for “sharpness”).

Instructions

(1) Chill a champagne coupe, martin glass or a lowball in the freezer or fill it with ice.

(2) Add all ingredients into a mixing glass filled with ice and stir until the drink is chilled. Typically, that takes no more than 20-30 seconds depending on the temperature of the ingredients and the nature of the ice.  A Manhattan must only ever be stirred; they are never shaken.

(3) Strain the drink into the chilled (and empty) Nick & Nora glass and (optionally) garnish the drink with a Maraschino cherry speared on a cocktail stick.

Purists like to stick to the classics but variations of the Manhattan have over the years been concocted:

A Black Manhattan replaces the Sweet Vermouth with Averna Amaro, a complex liqueur which delivers an aromatic experience.  It’s one of those drinks which need to be breathed in for some time before drinking.

In a Dry Manhattan, Dry Vermouth is used.  Most find it an acquired taste and described it as a “harder” drink,

The Rob Roy is known by some as the Scotch Manhattan and obviously, instead of Bourbon or Rye, it’s made on a Scotch Whisky base.  The aficionados of this kink seem all to recommend a blended Scotch rather than a pure malt.

The “perfect” in a Perfect Manhattan uses the word in its mathematical sense, the recipe calling for a 50/50 split between Dry & Sweet Vermouth.  The difference is said to be “very nuanced” and the choice of whiskey will notably change the experience.

First We Take Manhattan (1986) by Leonard Cohen

They sentenced me to twenty years of boredom
For tryin' to change the system from within
I'm coming now, I'm coming to reward them
First we take Manhattan, then we take Berlin
 
I'm guided by a signal in the heavens
I'm guided by this birthmark on my skin
I'm guided by the beauty of our weapons
First we take Manhattan, then we take Berlin
 
I'd really like to live beside you, baby
I love your body and your spirit and your clothes
But you see that line there moving through the station?
I told you, I told you, told you, I was one of those
 
Ah you loved me as a loser, but now you're worried that I just might win
You know the way to stop me, but you don't have the discipline
How many nights I prayed for this, to let my work begin
First we take Manhattan, then we take Berlin
 
I don't like your fashion business, mister
And I don't like these drugs that keep you thin
I don't like what happened to my sister
First we take Manhattan, then we take Berlin
 
I'd really like to live beside you, baby
I love your body and your spirit and your clothes
But you see that line there moving through the station?
I told you, I told you, told you, I was one of those



Of politics taken to its logical “other means” conclusion: First We Take Manhattan performed by Jennifer Warnes (b 1947), from the Album Famous Blue Raincoat (1986).

It was during the last years of the Cold War Canadian singer-songwriter Leonard Cohen (1934-2016) wrote First We Take Manhattan (1986), the lyrics of which were open to interpretation but clarified in 1988 by the author who explained: “I think it means exactly what it says.  It is a terrorist song.  I think it's a response to terrorism.  There's something about terrorism that I've always admired.  The fact that there are no alibis or no compromises.  That position is always very attractive.   Even in 1988 it was a controversial comment because by then not many outside of undergraduate anarchist societies were still romanticizing terrorists but in fairness to the singer the coda isn’t as often published: “I don't like it when it's manifested on the physical plane – I don't really enjoy the terrorist activities – but Psychic Terrorism.