Thursday, May 12, 2022

Bacchanal

Bacchanal pronounced (bah-kuh-nahl, bak-uh-nal, bak-uh-nl (noun) or bak-uh-nl (adjective))

(1) A follower of Bacchus.

(2) A drunken reveler.

(3) An occasion of drunken revelry; orgy; riotous celebration.

(4) Of or pertaining to Bacchus; bacchanalian.

1530-1540: From the Latin Bacchānālis (having to do with Bacchus) & Bacchānālia (feast of Bacchus), plural of Bacchānal (a place devoted to Bacchus), from Bacchus (the god of wine), from the Ancient Greek Βάκχος (Bákkhos).  By extension, the meaning "riotous, drunken roistering or orgy" dates from 1711.  Bacchus, known also as Dionysus (Διόνυσος) (Dionysos) was in Greek Mythology the god of the grape harvest, winemaking and wine, of ritual madness, fertility, theatre and religious ecstasy.  In Antiquity, most attention focused on wine and given consumption was both high and enthusiastic, the worship of Bacchus became firmly established.  A quirk of Bacchus’ place in the pantheon of gods is that, uniquely, he was born of a mortal mother.  The Romans adopted the name bacchanal (a woman given to such things was a bacchante) and named the behavior of those who had taken too much strong drink: bakkheia.  Bacchanal is a noun & adjective, Bacchanalia is a noun; the noun plural is bacchanals.

Bacchus and Ariadne

Bacchus and Ariadne (1717) by Giovanni Antonio Pellegrini (1675-1741).

In Greek mythology, Ariadne was the clever, though perhaps naïve, daughter of King Minos of Crete and she aided the hero Theseus in his mission to slay the Minotaur.  To say naïve might be understating things: poor sweet Ariadne was an emo and a bit of a dill.  On the island of Crete, there was a great labyrinth that housed a fearsome beast, the Minotaur, half human, half bull.  King Minos, in retaliation for his son's death at the hands of an Athenian, required the people of Athens every nine years to send seven young men and seven young virgins to be sacrificed to the beast, the alternative the destruction of their city.  One year, Theseus volunteered to be sent to Crete as part of the awful pact, planning to kill the Minotaur and thereby release his people from their plight.  When he stepped ashore in Crete, Ariadne spotted him and at once fell in love, as emos often do; running to Theseus, she offered to help him defeat the monster if he would marry her.  Theseus naturally agreed so Ariadne gave him a sword and a ball of red thread with which to mark his path so he could find his way out of the labyrinth.  The plan worked to the extent that Theseus slayed the Minotaur but certainly had no intention of marrying Ariadne.  While the couple traveled to Athens, during a brief stop on the island of Naxos, he sailed away, abandoning her while she slumbered on the beach.  Ariadne may have been an emo but Theseus was a cad.  Distraught by being deserted by the one she loved, Ariadne was still sobbing on the shore Bacchus appeared with a procession of his followers.  They spoke a few words and within moments had fallen in love, soon to marry.  In some tellings of the myths, after their wedding, Bacchus placed Ariadne's sparkling diadem in the sky as the constellation Corona, thus making her immortal.

A bacchante illustrating the consequences of what the Ancient Romans called bakkheia: Lindsay Lohan in a Cadillac Escalade, resting after dinner, Los Angeles, May 2007.

Wednesday, May 11, 2022

Inflammable & Flammable

Inflammable (pronounced in-flam-uh-buhl)

(1) Easily set on fire; combustible; incendiary, combustible, inflammable, burnable, ignitable (recommended only for figurative use).

(2) Easily aroused or excited, as to passion or anger; irascible; fiery; volatile, choleric.

1595–1605: From the Medieval Latin inflammābilis, the construct being the Classical Latin inflammā(re) (to set on fire) + -bilis (from the Proto-Italic -ðlis, from the primitive Indo-European i-stem form -dhli- of -dhlom (instrumental suffix).  Akin to –bulum, the suffix -bilis is added to a verb to form an adjectival noun of relationship to that verb (indicating a capacity or worth of being acted upon).  The construct of the Classical Latin inflammare (to set on fire) was -in (in, on) + flamma (flame).  As an indication of shifts in use, the verb inflame & noun inflammation are now most commonly used in clinical medicine to describe swellings, a site especially "reddish" often called "angry".  Inflammable is a noun & adjective, inflammation, inflammableness & inflammasome & inflammability are nouns, inflammatory is an adjective and inflammably is an adverb; the noun plural is inflammables. 

Flammable (pronounced flam-uh-buhl)

Easily set on fire; combustible; incendiary, combustible, inflammable, burnable, ignitable (technically a back-formation from inflammable).

1805–1815: From the Classical Latin flammā(re) (to set on fire) + -ble (the Latin suffix forming adjectives and means “capable or worthy of”).  Flammable is an adjective, flammability is a noun and flammably is an adverb; the noun plural is flammabilities.

Google ngram (a quantitative and not qualitative measure): Because of the way Google harvests data for their ngrams, they’re not literally a tracking of the use of a word in society but can be usefully indicative of certain trends, (although one is never quite sure which trend(s)), especially over decades.  As a record of actual aggregate use, ngrams are not wholly reliable because: (1) the sub-set of texts Google uses is slanted towards the scientific & academic and (2) the technical limitations imposed by the use of OCR (optical character recognition) when handling older texts of sometime dubious legibility (a process AI should improve).  Where numbers bounce around, this may reflect either: (1) peaks and troughs in use for some reason or (2) some quirk in the data harvested.

Need for standardization

Flammable and inflammable came to the same thing.  English, a mongrel vacuum-cleaner of a language, has many anomalies born of the haphazard adoption of words from other tongues but the interchangeability of flammable and inflammable is unfortunate because of the use in signs to warn people of potentially fatal danger.

Using flammable and inflammable to mean the same thing is confusing and at least potentially dangerous and the recommended use is flammable (things prone to catching fire) and non-flammable (things not).  To add another layer of meaning less language-dependent, borrowing from semiotics, danger should be indicated with red, safety with green.

In- often is used as a prefix with adjectives and nouns to indicate the opposite of the word it precedes (eg inaction, indecisive, inexpensive etc).  Given that, it would seem reasonable to assume inflammable is the opposite of flammable and the reason for the potentially deadly duplication is historic.  Inflammable actually pre-dates flammable, the word derived from the Latin verb inflammare (to set on fire), this verb also the origin of the modern meaning “to swell or to provoke angry feelings”, hence the link between setting something on fire and rousing strong feelings in someone.  So, at a time when Latin was more influential, inflammable made sense.  However, as the pull of Latin receded, words with in- (as a negative prefix) became a bigger part of the lexicon and the confusion was created; by early in the 1800s, flammable increasingly came to be used and in the next century, as the use and storage of flammable substances grew, use was widespread.  The modern convention is (or should be) to use flammable literally (to refer to things which catch fire) and inflammable figuratively (to describe the arousal of passions, the swelling of tissue etc.  Surprisingly, the rules applying to warning signs have yet to adopt this standardization.

The Mean Girls (2004) Burn Book (left) and Lindsay Lohan burning an “inflammatory” tabloid magazine, Lindsay Lohan: The Obsession, GQ Magazine, October 2006.

Uses figurative and literal: In Mean Girls, the Burn Book gained its notoriety from being packed with inflammatory comments.  Lindsay Lohan in 2006 picked up the concept in a photo-shoot by Terry Richardson (b 1965) for GQ (Gentlemen's Quarterly) magazine.  Titled Lindsay Lohan: The Obsession, the theme was her as a case-study of the way “tabloid publications” handled celebrity culture, the joke being a magazine with “inflammatory content about her” being literally set aflame, the glossy paper of course being flammable.  It’s appears a consensus in the “media studies” crew that this aspect of “tabloid culture” peaked in the first dozen-odd years of the twenty-first century, the reasons for that including (1) the period having an exceptionally large cast of suitable subjects, (2) smart phones with HD (high-definition) cameras becoming consumer items meaning potential content proliferated (ie what once would not have been photographed now became available to editors as low cost images) and (3) social media sites not having attained critical mass, all factors which at the time enabled the lower-end glossies to flourish.  Of course, what's not certain is the math of the "cause & effect".  Was what at the time seemed an "exceptionally large cast of suitable subjects" a fluke of history which encouraged the taking of photographs and their subsequent publication or did the growth in number of down-market glossies mean more "celebrities" had to be "manufactured" to provide the content?   

1972 Ford Ranchero 500 (left) and a circa 1972 Ford Pinto (right).

“Hot Rod Flames” first became popular when the West Coast hot rod community began adding them to their modified machines.  Rendered usually in red, orange and yellow to emulate actual flames, in the decades since they’ve appeared in many colors, sometimes in hues which would never be seen in nature and they’re now a commodity with templates and adhesives widely available; the motif was also picked up by the tattoo community.  Traditionally, when applied to a hot rod or other modified vehicle, the placement of the lick of the flames was quasi-realistic in that the effect was intended to be that of a flaming car in motion.  One widely circulated image however was of a Ford Pinto (1970-1980) with the flames travelling “the other way”: from the back towards the passengers.  The artwork was a sardonic comment on the Pinto’s reputation for bursting aflame if struck from behind by another vehicle, the allegation being Pintos were unusually flammable (the media tended to prefer the more dramatic “explosive”) in such cases because of the placement of the gas (petrol) tank and design of the fuel system.  In truth the Pinto’s susceptibility probably was little different from that of many other vehicles with a similar layout but what gained the modest machine notoriety was the discovery of “inflammatory” comments in internal corporate memoranda in which executives discussed the relative costs of rectifying the problem compared with the likely costs of legal settlements compensating incinerated victims and their families.

Combustibles magazine (4 December, 1972).

The troubling duplicity of meaning was explored by the editors of Combustibles magazine in their edition of 4 December, 1972.  There never was a Combustibles magazine (which may suggest a gap in the market for the entrepreneurial) but an archive of the (factitious) covers is maintained in the Lillian Virginia Mountweazel Research Collection.  Ms Mountweasel (1942-1973) was a creation of Karen Tweedy-Holmes (b 1942), then an editor at the New Columbia Encyclopedia who, for the publication's 1975 edition, needed a bogus entry to be inserted as a "copyright trap", the idea being that were the "facts" included to appear in any other publication, they'd obviously been plagiarized because the sad tale of Ms Mountweazel's life and demise appeared nowhere else.  The entry read: Mountweazel, Lillian Virginia, 1942–1973, American photographer, b. Bangs, Ohio.  Turning from fountain design to photography in 1963, Mountweazel produced her celebrated portraits of the South Sierra Miwok in 1964.  She was awarded government grants to make a series of photo-essays of unusual subject matter, including New York City buses, the cemeteries of Paris and rural American mailboxes.  The last group was exhibited extensively abroad and published as Flags Up! (1972).  Mountweazel died at 31 in an explosion while on assignment for Combustibles magazine.”  That same year, writing in The New Yorker, Henry Alford (b 1962) suggested "mountweasel" as a term to be used for copyright traps and dictionaries agreed; to this day it remains the preferred generic form and for this purpose, (unlike when used of the doomed heroine), mountweasel is used without an initial capital.

Combustibles magazine (Special Issue, 4 June, 1973).

Impressed by Ms Tweedy-Holmes' (there can have been few finer names for a lexicographer) creation, the curators of the Lillian Virginia Mountweazel Research Collection fleshed-out the tale of the life and death of the tragic American fountain designer turned photographer, most noted for her Flags Up! project, a commissioned series of images of the mailboxes of rural America.  Her other assignments included The Cemeteries of ParisThe Whimsical History of Fireworks” and “Disturbing Revelations” about Nazi rocket scientist Wernher von Braun (1912–1977) who in 1945 had been employed by the US government, suddenly rather more interested in the missiles the German could help them build rather than his wartime use of slave labor.  A darker side also was revealed: Flags Up!, although promoted as the USPS (US Postal Service) using “captivating imagery” to demonstrate how the new ZIP codes enhanced “the efficiency and modernization of the postal system”, actually was funded by the CCF (Congress for Cultural Freedom), a CIA (Central Intelligence Agency) “front organization” used during the Cold War to produce anti-Soviet propaganda.  The “messaging” in Flags Up! was to show the way freedom of thought and the expression of ideas was allowed freely to flow between Americans, however remote they might be.  Of course, also included is the “special issue” of Combustibles (4 June, 1973) in which was announced the death the previous day of Ms Mountweazel, killed in the crash of a Soviet Tupolev Tu-144 SST (supersonic transport) passenger airliner during the 1973 Paris Air Show at Le Bourget Airport.  In the accident, all six crew members died along with eight in the nearby village of Goussainville, Val-d'Oise where Ms Mountweasel had been researching “the negative health effects of sound pollution in communities near major international airports.”  After her death, photojournalism scholar Pierre Menard, acknowledged Ms Mountweazel as one of the most important in the world of pyromaniac publishing.”  Pierre Menard was also factitious, the name borrowed from Pierre Menard, autor del Quijote (Pierre Menard, Author of the Quixote (1939)), a short story by the Argentine writer Jorge Luis Borges (1899-1986).

Tuesday, May 10, 2022

Portmanteau

Portmanteau (pronounced pawrt-man-toh)

(1) A case or bag to carry clothing in while traveling, made usually from stiff leather, hinged at the back so as to open out into two compartments

(2) A word created by blending two or more existing words.

1580s (for the travelling case (flexible traveling case or bag for clothes and other necessaries)): From the Middle French portemanteau (travelling bag, literally "(it) carries (the) cloak").  The original meaning from the 1540s was “court official who carried a prince's mantle" from porte, (imperative of porter (to carry) + manteau (cloak)).  The correct plural is portmanteaux but in modern English use, portmanteaus (following the conventions for constructing plurals in English) is now more common.  In the nineteenth century, the word was sometimes Englished as portmantle, a use long extinct.  The notion of the portmanteau word (word blending the sound of two different words) was coined by Lewis Carroll (pen-name of Charles L. Dodgson; 1832-1898) in 1871 for the constructions he invented for Alice Through the Looking-Glass such as Jabberwocky, his poem about the fabulous beast the Jabberwock.  Portmanteau in this sense has existed as a noun since 1872.

Vintage Louis Vuitton Portmanteau, typically circa US$50-80,000 depending on condition.

A portmanteau word, a linguistic blend, differs from contractions and compounds.  Contractions are formed from words that would otherwise appear together in sequence, such as do + not to make don't, whereas a portmanteau word is joins two or more words that relate to the one contractual theme.  A compound word is merely the joining for words in their original form (eg under + statement) without any truncation of the blended words.  Portmanteau words (eg breakfast & lunch to create brunch) always modifies at least one of the original stems.

Lindsay Lohan's handy moniker Lilo (the construct being Li(ndsay) + Lo(han) and it's used sometimes as LiLo) is a portmanteau word.

The word portmanteau was first used in this sense by Lewis Carroll in Alice Through the Looking-Glass (1871) where the concept is helpfully explained by Humpty Dumpty.  Less erudite but just as amusing was the creation of refudiate by Sarah Palin when she got confused and conflated refute and repudiate although it’s unclear whether she knew the meaning of either.  Even those created or used by more literate folk are not always accepted.  Irregardless (portmanteau of regardless and irrespective) seems to stir strong feelings of antipathy in pedants who generally won’t accept it even as a non-standard form and insist it’s simply wrong.  Other languages also create blended forms as needed.  The title of Emile Habibi’s 1974 novel was translated from Arabic utashaʔim (pessimist) + mutafaʔil (optimist) into English as The Pessoptimist.  Arabic linguistic traditions however prefer acronyms and compounds which sometimes overlap.  The group known variously as ISIL or ISIS (although they came to prefer "caliphate" or "Islamic State" (IS)) first adopted the name ad-Dawlah al-Islāmiyah fī 'l-ʿIrāq wa-sh-Shām (Islamic State if Iraq and the Levant) which is usually written as Daesh or Da'ish.  IS think this derogatory as it resembles the Arabic words daes (one who tramples underfoot) and dāhis (those who sows discord).  IS threatened to punish those who use Daesh or Da'ish with a public flogging; repeat offenders promised the cutting out of the tongue.

In the manufacture of big words, English is unlikely ever to match the Germans.  Until changes in EU regulations rendered it obsolete, the longest word in the Fourth Reich was rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz (law delegating beef label monitoring).  Currently, the longest word accepted by German dictionaries is kraftfahrzeughaftpflichtversicherung (automobile liability insurance), editors rejecting donaudampfschifffahrtsgesellschaftskapitaenswitwe (widow of a Danube steamboat company captain) because of rarity of use.

Sunday, May 8, 2022

Strudel

Strudel (pronounced strood-l or shtrood-l (German))

(1) A pastry, usually consisting of a fruit, cheese, or other mixture, rolled in multiple layers of paper-thin sheets of dough and baked.

(2) In the slang of computing, the “at” symbol (@).

(3) In oceanography, a vertical hole in sea ice through which downward jet-like, buoyancy-driven drainage of flood water is thought to occur.

(4) In engineering and graphic design, a general descriptor of spiral shaped objects.

1893: From the German Strudel (literally “eddy, whirlpool”), from the Middle High German strodel (eddy, whirlpool), from the Old High German stredan (to bubble, boil, whirl, eddy), from the Proto-Germanic streþaną, from the primitive Indo-European verbal stem ser- (to flow) from serw (flowing, stream).  The dish was so-called because of the way the pastry is rolled.  Strudel is a common dish throughout European and languages as diverse as the Norwegian Bokmål, Polish and Portuguese borrowed the German form directly.  In Hebrew colloquial speech, the @ symbol (famous from the use in email addresses) is known as the שטרודל (shtrudel), an allusion to the traditionally spiral form of strudels.  Hebrew is a centrally controlled language and the official word for the @ symbol is כרוכית (keruchith) which is used for the pastry although the loan-word from German is not uncommon in colloquial speech.  To a pâtissier, a strudel is something quite specific but to the less skilled the word is often applied to a variety of cakes, filled croissants, phyllo creations, pies & dainties, patisseries, tarts, turnovers, éclairs and panettone.  The noun plural is strudels. 

Most associated with sweet fillings, most famously apple and cherry, there are also savory strudels which have always been especially popular in Eastern Europe, constructed often with a heavier pastry.  Although the name strudel has been recorded only since 1893, it’s an ancient recipe which has probably been used since thin bread or pastries were used to encase and cook fruit, probably sweetened with honey.  Recipes from the seventeenth century still exist and historians have noted the cross-cultural exchanges with the cuisine from West Asia and the Middle East, such as the influence of the baklava and some Turkish sweets.  Early in the eighteenth century, strudels became signature items in many Vienna pâtisseries and from there became popular throughout the Habsburg Empire and beyond, noted particularly in the north of Italy.  In addition to apples (often with raisins) and cherries (sour, sweet & black), other popular fillings include plums, apricots and rhubarb, the French and English making a specialty of the latter.  Many strudels, especially the apple-based, are also augmented with a variety of creamy cheeses.

Toaster Strudel is a packaged convenience food, prepared by heating the frozen pastries in a domestic toaster, the icing included in a separate sachet.  There were in the 1950s attempts to create pastries which could be frozen and heated by consumers in toasters but it wasn't until the 1980s that advances in the manufacturing equipment and techniques used in the industrial production of food made mass-production and distribution practical.  Toaster Strudel is marketed under the Pillsbury brand operated by private equity investment house Brynwood Partners and has been on sale since 1985.  The core flavors are the original three, strawberry, blueberry and apple but twelve are currently on sale including a popular chocolate variety and from time to time, Pillsbury have offered different blends.  In the movie Mean Girls (2004), it was fictitiously claimed Gretchen Wieners' (Lacey Chabert (b 1982)) family fortune was due to her father's invention of Toaster Strudel; it was one of the script's running gags.


Still pink after all these years: Lacey Chabert.

In 2020, Pilsbury released a promotional version of Toaster Strudel, promoted by Lacey Chabert who is depicted reprising the famous line: “I don't think my father, the inventor of Toaster Strudel, would be too pleased to hear about this” although on the actual product it’s written as “…very pleased to hear about this", a change which seems not significant.  The limited-edition release came in Strawberry & Cream Cheese and Strawberry, the icing (of course) pink and the day of release (of course) a Wednesday.  As part of the promotion, Pillsbury announced The Most Fetch’ Toaster Strudel Icing Sweepstakes, in which contestants created a design on their toasted strudel using the pink icing and there were three grand prize winners, each of whom received a personalized video message from Ms Chabert, a year’s supply of Toaster Strudel and some Mean Girls merchandise.  The list of winners was announced on Twitter (#FetchSweepstakes) and Instagram (@ToasterStrudel) on 3 October 2020 which was (of course) National Mean Girls Day.

Black Cherry Strudel

To ensure the finest product, pâtissiers often insist on using only fresh fruit but canned or frozen black cherries work equally well in strudels and can be much easier to work with because there’s no need to macerate the fruit which may instead immediately be cooked.  This recipe can also be used with sour cherries in which case the lemon juice is omitted in favor of 150 g (¾ cup) of sugar.  It can be served warm or cold according to preference and the variations are many; the cranberries and almonds can be replaced with other dried fruits and nuts and there are the purists who insist on nothing but black cherries (although a few do add apricot brandy).  Traditionally, it’s served with a dollop of thickened cream.

Ingredients

800 g (3½ cups) fresh black cherries, cleaned and pitted
100 g (½ cup) granulated sugar
3 tablespoons cornstarch
1 teaspoon vanilla extract
A dash of cinnamon
Juice and zest of 1 organic, un-waxed, scrubbed lemon
60 g (½ cup) dried cranberries
50 g (½ cup) slivered almonds
6 large sheets strudel or filo pastry
1 egg whisked with 1 tablespoon milk or water for brushing
Icing sugar for dusting

Instructions

Preparation: Preheat oven to 200°C (400°F).  Line a baking tray (or sheet) with baking (parchment) paper.

Cook cherry filling: In a small bowl, whisk together 3 tablespoons of sugar and cornstarch until no lumps of cornstarch remain.  Add the cherries and the remaining sugar into another bowl and allow them to let macerate for an hour (it will take this long for the sugar to draw some liquid from the fruit).  Add the cherries, cranberries, almonds, cornstarch mixture, vanilla extract, cinnamon, lemon zest and juice into a saucepan and simmer over medium-high heat until the mixture starts to thicken, which should take 7 to 10 minutes.  Set the mix aside to cool to room temperature.

Roll strudel (pastry): Place the sheets of strudel or filo pastry on a clean, dry tea-towel (one with some embossing does make rolling easier).  Arrange the cherry filling lengthwise on the pastry leaving a 25 mm (1 inch) border along bottom and sides and then fold in the edges.  Use the tea-towel to lift and roll the pastry tightly, enclosing all the filling.  Tuck the ends in and transfer the strudel seam-side down onto the prepared baking tray.  If using filo pastry, brush each sheet with melted butter to prevent it drying out during the cooking.

Bake strudel:  Brush the top of the strudel with egg wash and bake for 25-35 minutes, until the pastry has become golden brown and obviously flaky.  Slice the strudel while still warm and dust with icing sugar; it’s traditionally served with custard, ice cream or a dollop of thickened cream.

Saturday, May 7, 2022

Bandage

Bandage (pronounced ban-dij)

(1) A strip of soft cloth or other material used to bind up a wound, sore, sprain etc, or as a protective compression device to prevent or limit injury.

(2) Anything used as a band or ligature.

(3) To bind or cover with a bandage; to put a bandage on a wound, sprain etc, or as a protective compression device to prevent or limit injury.

(4) In fashion, a type of dress, distinguished from similar styles by the use of knitted fabrics.

(5) Figuratively, by extension, a provisional or makeshift solution that provides insufficient coverage or relief (also as band-aid solution).

1590-1600: From the Middle English bandage (strip of soft cloth or other material used in binding wounds, stopping bleeding etc), from the sixteenth century French bandage, from the Old French bander (to bind), from bande (a strip).  The verb bandage (to dress a wound etc, with a bandage) dates from 1734 (and was implied in bandaging).  Bandage is the spelling in Danish, Dutch, German, English & Swedish but other languages localized the French including Norwegian Bokmål (bandasje) Polish (bandaż) & Turkish (bandaj).  The spelling in the constructed Esperanto is bandaĝo.  Bandage is a noun, verb & adjective, bandaged & bandaging are verbs (used with & without an object) and the noun bandager does exist although use seems restricted to first-aid manuals.  Other words used in similar vein include dressing, gauze, plaster, swathe, truss, compress, bind & wrap.  The noun plural is bandages.

The noun compress, (in the surgical sense of "soft mass of linen or other cloth to press against some part of the body (with the aid of a bandage)”), as an adaptation from the earlier verb, evolved in the 1590s in parallel with bandage.  In earlier use, the noun ligament (band of tough tissue binding bones) was a late fourteenth century creation from the Latin ligamentum (a band, bandage, tie, ligature), from ligare (to bind, tie), from the primitive Indo-European root leig- (to tie, bind) and in the medical literature, ligamental, ligamentous & ligamentary still occasionally appear.  One technical term from medicine which seems extinct is the verb deligate (to bind up, bandage), noted since 1840 (and implied in deligated), from the Latin deligatus (bound fast), from deligare (to bind fast), the construct being de- (from the Latin dē-, from the preposition (of, from); the Old English æf- was a similar prefix) + ligare (to bind).  Under the Raj, the noun puttee (long strip of cloth wound round the lower leg as protection by soldiers) enjoyed a evolution in spelling typical of many words in British India, patawa in 1875, puttie by 1886 and the modern puttee finally (more or less) standardized by 1900).  The source was the Hindi patti (band, bandage) from the Sanskrit pattah (strip of cloth).  The noun fascia did have a brief career in medicine, being from the Latin fascia (a band, bandage, swathe, ribbon), derivative of fascis (bundle (which as fasces became a familiar form in the twentieth century)).  In English, the original use was in architecture, the anatomical application not noted until 1788 and it’s now also a familiar form in botany, music, astronomy and interior design, most obviously in cars.  The noun bandeau (headband), now much associated with revolutionaries (and in fashion the emulation) dates from 1706, from the French bandeau, from the twelfth century Old French bandel & bendel (bandage, binding), a diminutive of bande (a band, a strip).  As a style of women's top or bra, it was first described in 1968 and is distinguished from similar styles in being of a rectangular cut, the hems forming two horizontal lines above and below the breasts.

The bandage dress

Although the motif of what is called the bandage dress is clearly identifiable in depictions of women which pre-date antiquity, the creation of the modern commercial product is credited to the 1980s work of Tunisian couturier Azzedine Alaïa (1935-2017) but it is with French designer Hervé Peugnet’s (1957–2017) fashion house Hervé Léger that the style is now most associated.

Charlotte McKinney (b 1993), 2018.

The bandage dress is a specific interpretation of the earlier, figure-hugging bodycon dress, the name originally a contraction of "body conscious" which the industry would later morph into "body confidence" in reaction to criticism and in Japan, they were marketed as ボディコン (bodikon), a spelling better suited to traditional pronunciation in Japanese.  What distinguished bandage from bodycon was the fabric, the former made not with anything woven, engineered instead to compress with machine-knitted material, the completed panels left uncut and assembled to created the finished item.  Bandage dresses thus, although truly suitable for only one body type, because of the compression effect of the knitted fabric, do (slightly) extend the parameters of the silhouette which can be accommodated while still being aesthetically successful whereas bodycon dresses made from fabrics which merely cling rather than smooth out imperfections rely on an ideally formed frame.  For that reason, the jocular slang “body compression” was sometimes used to describe this sub-set of the bodycon, the bandage dress working like externally worn shapewear, corset-like in effect if not quite an actual exoskeleton.

Lindsay Lohan (b 1986), 2008.

Hervé Léger in 1992 first displayed the bandage dresses which would come to be the style’s definitive look; instantly popular, they were a red-carpet staple well into the twenty-first century.  Still a big seller, the bandage dress in 2015 migrated, via the twittersphere, from the fashion section to the front page when the comments of Patrick Couderc (b 1961, then managing director of Hervé Léger's British distributor, MJH Fashion), were published.  In an interview with the Daily Mail on Sunday, Mr Couderc made it clear he’d prefer it if some women would avoid buying Hervé Léger’s most famous creation, those on the proscribed list including lesbians, those beyond a certain age and anyone with a less than ideal silhouette.

There was an element of classism too in his critique as he lamented the bandage dress as a victim of its own success, too many now seen on the wrong-shaped customers and worse still, they were often cheap knock-offs of the £1,300 (US$1603) originals and thus increasingly associated with reality TV stars and those working in hair salons.  Admitting dryly “you can be a victim of your success”, his comments seemed to echo those reported earlier in the century by the distributers of a high-end cognac and the Maybach, Daimler-Benz’s ill-fated mistake in thinking what was needed was a brand above Mercedes-Benz which for almost a century had been good enough for presidents, popes and potentates.  Then the complaint had been that drink and car were finding favor with hip-hop & rap stars and this most interpreted as an expression of concern the association with people of color might “cheapen the brand”.  Mr Couderc didn’t comment on skin color but told The Mail he refuses to give free dresses to celebrities if they are “judged to lack sufficient class”.

Clearly a student of the interplay of sociology and economics, he allowed his mind to wander wide, recalling that he’d “...never go out to dinner if she’s not wearing tights.  I think hosiery is something which is very magical in my world and I’m veering off into complete poetry now.  But it’s a social statement because in the 1980s, the difference between someone who was wearing tights and someone who was not was very significant.”  Clearly nostalgic for a time when the poor were less inclined to get ideas above their station, he added that then, “...whoever was wearing tights was working in a private office in a bank in St James’s and whoever was not wearing tights was coming to work as a shampooist in a High Street hairdresser, commuting from Croydon.  We were living in a time where the distinction between the two social strata was much more significant than today”.  How he must long for that vanished, pre-1945 world, when folk from Croydon were deferential to their betters.

Salma Hayek (b 1966), 1998.

The attitude was hardly unique in the industry, Abercrombie & Fitch early in the century re-built into a highly profitable company using a model former CEO Mike Jeffries (b circa 1944) described in a 2006 interview as “exclusionary” noting their clothes were a product in which “a lot of people don’t belong and they can’t belong.”  That really wasn’t an unusual business model but it was rare for a CEO so bluntly to state the obvious and, when the comments were published in 2013, Jeffries issued a apology saying "We are completely opposed to any discrimination, bullying, derogatory characterizations or other anti-social behavior based on race, gender, body type or other individual characteristics".  Also controversial was a later comment, attributed in 2013 to (an unnamed) Abercrombie and Fitch district manager.  It’s said the person being interviewed requested anonymity so the statements have never been verified but it was reported that when asked how the company responds to non-profits asking for donations of discontinued clothing to be given to the poor and homeless, the reply was “Abercrombie and Fitch doesn’t want to create the image that just anybody, poor people, can wear their clothing. Only people of a certain stature are able to purchase and wear the company name”, to which he added they would rather “burn the clothes” than risk them being seen on the backs of the poor.  Again, while rarely discussed, the practice of destroying rather than discounting or giving away unsold or discontinued items is widespread in the industry.

Speaking at Hervé Léger’s boutique in Knightsbridge, Central London, the like-minded Mr Couderc wasn’t entirely lacking in empathy, noting “You women have a lot of problems. You will lose the plot.  You will come and you will put a dress on and you’ll be in front of the mirror, like, ‘Argh, I’m so fat’”.  “Yes, you have a 12th of an inch around your stomach, it’s not really a disaster, and what you’re not noticing is that your cleavage is about two inches too low because you are 55 and it’s time that you should not display everything like you’re 23.”  At this point he did concede the particular virtue of the bandage dress was it could in such cases “provide useful support” but that didn’t mean he approved.

How a Hervé Léger bandage dress should hang.

He’d clearly thought about things, his advice to lesbians (presumably young or old) that “if you’re a committed lesbian and you are wearing trousers all your life, you won’t want to buy a Léger dress.  Lesbians would want to be rather butch and leisurely.”  Warming to the topic, he went on to say “voluptuous” women (most drawing the inference he meant "not slender") and those with “very prominent hips and a very flat chest” should wear something else, adding the handy hint that women must not wear underwear that was too small, because “the knicker line cuts through the flesh and goes through the other side of the dress” thereby creating the dreaded “visible panty line” (VPL).

Hervé Léger’s Moscow store.

Quite what he thought the reaction to his comments would be isn’t recorded but while his views may not much have changed since the 1980s, much of the rest of the world now has the means to respond en masse and what should have been the foreseen twitterstorm quickly gathered, #boycottherveleger & #wecanwearwhateverthefuckwewant soon trending.  Doubtlessly fearing the wrath of blood-thirsty lesbians, those not slender, chav shampooists and women of a certain age, Max Azria’s BCBGMAXAZRIA Group (which in 1998 had acquired Hervé Léger), went immediately into crisis management mode, issuing a statement saying they were “...shocked and appalled by Patrick Couderc’s comments made in the Mail on Sunday.  BCBGMAXAZRIA Group is working in concert with MJH Fashion, the London-based licensee of the Herve Leger brand, to investigate and establish appropriate next steps. The statements made by Mr. Couderc are not a reflection of Herve Leger by Max Azria or MJH Fashion ideals or sentiments.”  The Herve Leger by Max Azria brand celebrates sensuality, glamour and femininity without discrimination.”

Less than twenty-four hours later, MJH Fashion confirmed Mr Couderc was no longer employed by the company.  Max Azria (1949–2019) in 2016 ended his connection with BCBGMAXAZRIA and its associated companies and in 2017 the group filed for Chapter 11 bankruptcy protection, the intellectual property rights and assets later acquired by the Marquee Brands division of the Global Brands Group.  Bandage dresses remain popular.