Neutrino

Neutrino (pronounced noo-tree-noh, nyoo-tree-noh)

In physics, a stable elementary particle, classified as a lepton which has an extremely small (but nonzero) mass and no electric charge. Travelling at the speed of light, it interacts with the surroundings only via the weak force or gravitation, making it very difficult to detect.  Three types exist, associated with the electron, the muon, and the tau particle.  The neutrino symbol is a V.

1932: Coined by Italian physicist Enrico Fermi (1901-1954), the construct being neutr(on) + -ino.  Neutron was a formation of neutral +‎ -on (the suffix forming nouns denoting subatomic particles (proton), quanta (photon), molecular units (codon), or substances (interferon).  It was coined by Scottish-Australian physicist William Sutherland in 1899 in a paper in the Philosophical Magazine. Subsequent usage was sporadic and theoretical, sometimes referring to neutrinos rather than neutrons, and the modern sense was reintroduced by New Zealand physicist Ernest Rutherford (1871-1937) in 1920.  The Italian diminutive suffix –ino (plural -ini, feminine -ina) is from the Latin -īnus, from the primitive Indo-European –iHnos (and is most comparable with the English suffix –ine).  It’s (1) an alterative suffix used to form diminutives, (2) a derivational suffix used to form adjectives or nouns, (3) used to indicate an ethnic or geographical origin, (4) used to indicate tools or instruments and (5) used to derive adjectives denoting composition, colour or other qualities.  In Italian, neutrino means “little neutron”.  Neutrino is a noun; the noun plural is neutrinos 

They're everywhere

Although not observed until 1955, Austrian-Swiss physicist Wolfgang Ernst Pauli (1900-1958) created a theoretical model in 1930 of what he called the neutron, the word modelled on electron.  He speculated his new particle was emitted from the nucleus together with the electron or beta particle in the process of decay.  The word neutrino entered the scientific lexicon after Italian–American physicist Enrico Fermi used it at a Paris conference in 1932.  Neutrinos are among the most abundant particles in the universe, billions of which produced by nuclear reactions in the sun pass through every human body on earth every second without disturbing any atoms.  An incalculable number were created fractions of a second after the Big Bang and new ones are constantly being generated, in the nuclear hearts of stars, in particle accelerators and atomic reactors on Earth, during the explosive collapse of supernovas and when radioactive elements decay. Physicists estimate, at any given point in time or space, there are a billion times more neutrinos than protons in the universe.

A perfect gift for nerds, neutrino T-shirts are available in designer colors. 

Despite their ubiquity, neutrinos remain mysterious, streaming through most matter as if they were light rays going through a transparent window, scarcely interacting with everything else in existence.  They made the headlines in 2011 when researchers in Italy suggested they had detected neutrinos traveling faster than the speed of light, hitherto thought impossible.  Technical faults in the measurement were later detected and neutrinos resumed their place as cosmically law-abiding particles.  Later reports from the US indicate the possibility a fourth type (the so-called sterile neutrino) might exist; if detected, known laws of physics would have to be amended because sterile neutrinos don't fit into what's known as the Standard Model, a framework that explains almost all known particles and forces except gravity.  A new analytical framework would be required.

Parsec

Parsec (pronounced pahr-sek)

A unit of astronomical length, based on the distance from Earth at which a star would have a parallax of one second of arc which is equivalent to 206,265 times the distance from the earth to the sun or 3.26 light-years.  Its lineal equivalent is about 19.1 trillion miles (30.8 trillion km).

1913: The construct was par + sec, derived from parallax + second.  Parallax is from the Middle French parallaxe, from the Ancient Greek παράλλαξις (parállaxis) (alteration) from παραλλάσσω (parallássō) (to cause to alternate) from ἀλλάσσω (allássō) (to alter) from ἄλλος (állos) (other).  Second, in the sense of time, is from the Middle English secunde & seconde, borrowed from the Old French seconde, from the Medieval Latin secunda, short for secunda pars minuta (second diminished part (of the hour)). Parsec is a noun; the noun plural is parsecs.

Distance in space

The parsec (pc) is a unit of length used to measure large distances to astronomical objects outside the Solar System.  A parsec is defined as the distance at which one astronomical unit subtends an angle of one arc second, which corresponds to 648000 astronomical units.  The nearest star to Earth, Proxima Centauri, is about 1.3 parsecs (4.2 light-years) from the Sun.

The parsec unit appears first to have been suggested in 1913 by the English astronomer Professor Herbert Hall Turner (1861-1930).  It was invented to permit calculations of astronomical distances using only raw observational data and is thus the default unit of measure in astronomy and astrophysics although the more-easily understood light-year is preferred by lay-persons.  While useful to describe the comparatively short distances within the Milky Way, multiples of parsecs are needed to map the wider universe including kiloparsecs (kpc) for objects immediately beyond the Milky Way and megaparsecs (Mpc) for more distant galaxies.  Gigaparsecs (Gpc) are used to measure the quasars and galaxies which exist at the extreme edge of the known universe; the particle horizon (the boundary of the observable universe) has a radius of about 14.0 Gpc (46 billion light-years).

Although in use for more than a century, the parsec wasn’t formally defined until August 2015 when the International Astronomical Union (IAU) which, as part of the definition of a standardized absolute and apparent bolometric magnitude scale, noted the existing explicit definition of the parsec as exactly 648000 astronomical units, or approximately 3.08567758149137×10¹⁶ metres.

Hubble telescope image of star-forming region in the Carina Nebula.  As photographed, the gas and dust cluster is about .889 of a parsec (2.9 light-years) tall.

Stratosphere

Stratosphere (pronounced strat-uh-sfeer)

(1) The region of the upper atmosphere extending between the tropopause and mesosphere to about 30 miles (50 kilometers) above the earth, characterized by little vertical change in temperature.

(2) In historic documents, all of the earth's atmosphere lying outside the troposphere (obsolete).

(3) Any great height or degree of anything, as the highest point of a graded scale.

(4) In geology, collectively, those layers of the Earth’s crust which primarily comprise stratified deposits (obsolete).

1908: From the French stratosphère, the construct being strato + sphère (literally "sphere of layers").  It was coined by French meteorologist Léon-Philippe Teisserenc de Bort (1855-1913).  Strato was an inflected form of strātus (a spreading out), the perfect passive participle of sternō (spread) and past participle stem of sternere (to spread out) from the primitive Indo-European root stere- (to spread).  Sphere was from the Middle English spere, from the Old French sphere, from the Medieval Latin sphēra, from the Classical Latin sphaera (ball, globe, celestial sphere), from the Ancient Greek σφαῖρα (sphaîra) (ball, globe) of unknown origin and despite the apparent similarity, not related to the Persian سپهر‎ (sepehr) (sky).  The earlier use of the word, attested in English 1908 and coined in German 1901, was a geological term for part of the Earth's crust and has long been wholly obsolete.  The second major layer of Earth's atmosphere, the stratosphere sits above the troposphere and below the mesosphere.  Itself stratified, the stratosphere’s cooler layers are closest to the Earth’s surface, the higher layers warmed by the absorption of the Sun's ultraviolet radiation in the ozone layer, a reversal of the process in the troposphere where temperature decreases with altitude.  Stratosphere is a noun, and stratospheric & stratospherical are adjectives; the noun plural is stratospheres.

Layers

It was once thought the first living things to enter the stratosphere were some fruit flies, sent there by the US Air Force aboard one of the V-2 rockets seized from the German's wartime missile programme.  Launched in February 1947 from the White Sands Missile Range in New Mexico, the purpose of the flight was to explore the effects of radiation exposure at these then novel high altitudes; the V2 attained a height of 68 miles (109 kilometres) and all fruit flies survived the trip.  It was soon appreciated however that some bacteria or viruses must have been present in or on the V2s launched by the Germans between 1944-1945 and many of these would, at least briefly, have entered the stratosphere but even these appear not to have been the first living (and viruses are in some sense “alive”) things there.

Although the tropopause (the uppermost layer of the troposphere) is thought a barrier to the upward movement of particles, volcanoes are an obvious means by which this could occur although such eruptions are rare.  Bacterial life does however survive in the stratosphere, making it technically, part of the biosphere and, in 2001, dust was collected at a height of 25 miles (41 kilometres) which, upon analysis, was found to contain bacteria of surprisingly large size.  The discovery excited speculation that such large bacterial masses may be incoming to Earth, the suggestion being that (1) the bacteria may have arrived in the stratosphere from space and (2) the possibility that the transfer of bacteria from the Earth to the highly mutagenic stratosphere may have played a role in bacterial evolution.  Among the scientific community, enthusiasm for these theories was restrained.

Lambeth

Lambeth (pronounced lam-bith)

(1) A south London suburb, the location of Lambeth Palace, the seat of the Archbishop of Canterbury.

(2) A slang term for the hierarchy of the Church of England.

The name Lambeth embodies hithe, a Middle English word for a landing on the river.  Lambeth Palace has for some eight-hundred years been the official London residence of the Archbishop of Canterbury.  It sits on the south bank of the Thames, a quarter mile (400m) south-east of the Palace of Westminster, which contains the houses of parliament, on the opposite bank.

Rowan Williams (b 1950; Archbishop of Canterbury 2002-2012) and Benedict XVI (1927–2022; pope 2005-2013, pope emeritus 2013-2022) chat at Lambeth Palace.

The Lambeth Conference

The Lambeth Conference is a (nominally) decennial assembly of bishops of the Anglican Communion convened by the Archbishop of Canterbury.  There have been fourteen Lambeth Conferences, the first in 1867.  The Anglican Communion is an international association of autonomous national and regional churches, not a governing body and the office of Archbishop of Canterbury is in no way analogous with the Roman Catholic Pope.  The conferences serve a collaborative and consultative function and are said to express “…the mind of the communion" on issues of the day. Resolutions passed at a Lambeth Conference are without legal effect, but can be influential.

Conferences were never the pure and high-minded discussions of ethics, morality and theology some now appear to believe characterized the pre-modern (in this context those held prior to 1968) events.  Agenda and communiqués from all conferences have always included the procedural, administrative and jurisdictional although in recent years, they’ve certainly reflected an increasingly factionalized communion rent with cross-cutting cleavages, first over the ordination of women and of late, homosexual clergy.  During the 1998 conference, Bishop Chukwuma (b 1954) of Nigeria attempted to exorcise "homosexual demons" from the soul of Nigerian-born Richard Kirker (b 1951), a British priest and general secretary of the Lesbian and Gay Christian Movement.  Recalling probably Ephesians 4:32 or perhaps the more cautionary Matthew 6:15, Kirker forgave him.

The spirit of Kirker notwithstanding, at this point, the disagreements seem insoluble.  The poisonous atmosphere at, and in the aftermath of, the last conference in 2008 did not enhance the image of the church and a typically Anglican solution to avoid a repetition in 2018 seemed to have emerged.  In 2014, in answer to the suggestion he had cancelled the 2018 conference, Archbishop Justin Welby (b 1956; 105th Archbishop of Canterbury 2013-), in a statement worthy of any of his predecessors, responded by stating, "As it hasn’t been called, it can’t have been cancelled."

A communiqué issued after the primates' meeting in January 2016, noted the bishops had accepted the archbishop’s proposal the fifteenth conference should be held in 2020.  However, because of the COVID-19 pandemic, it was in March 2020 decided to postpone the conference to the summer of 2021 but the virus proved elusive and by July, the delay had been extended to 2022.  The first epistle of Peter has been chosen as the biblical focus for the conference, the theme of which is said to be what it means to be “God’s Church for God’s World”.  The apostle Peter wrote this epistle to give comfort to Christians suffering persecution from non-believers, hoping to encourage them to live pure lives despite their vicissitudes.

#lambeth got tagged in Lindsay Lohan's political commentaries on the dramatic night of the Brexit referendum in 2016.  She was a part of Team %remain.  

Peter didn’t sugar-coat the message (1 Peter 4:12-19), making it clear that for Christians, suffering is actually a participation in the sufferings of Christ and is an occasion for rejoicing, helpfully adding that in the midst of the suffering, the Holy Spirit rests upon those who are suffering, this being a great consolation.  He further explains that God uses suffering to purify the Christian community, God's household.  God uses the abuse that pagans unjustly heap on Christians to prepare his people for the return of Christ and warns people not to be surprised at the fiery ordeal that will come upon them as followers of Jesus.  Actually, they should be both grateful and happy and thus glorify God, for if they share in Christ’s sufferings it means they will also share in his glory.

In a world beset by fire, flood, pestilence and plague, 1 Peter seems a good theme to loom over a Lambeth Conference.  Whether or not Christians beyond the Kent conference rooms will long note the message, it probably will resonate with Archbishop Welby’s predecessor, Rowan Williams (Baron Williams of Oystermouth, b 1950; 104th Archbishop of Canterbury, 2002-2012).  During his tenure at Lambeth, Dr Williams probably felt more ignored than persecuted by non-believers, finding the internecine squabbles of the believers in the Anglican factions rather more tiresome.  Declaring the problems in the church “insoluble” he seemed not unhappy to be leaving Lambeth to return to his study and write about Dostoevsky.  A generous spirit, he will have wished his successor well.

Cabotage

Cabotage (pronounced kab-uh-tij or kab-uh-tahzh)

(1) In seafaring, navigation or trade along the coast.

(2) In aviation, the legal restriction to domestic carriers of air transport between points within a country's borders (with certain exceptions).

(3) The transport of goods or passengers between two points in the same country; the exclusive right of a country to control such transport.

(4) In law, the right to engage in such transport.

1825–1835: A borrowing from the French cabotage (coasting trade) from the French caboter (to sail coastwise; to travel by the coast), a verbal derivative of the Middle French cabo & the Spanish cabo (headland; cape).  Ultimate root is the Latin caput (head).  Word was first used in sixteenth century France to reference the restrictions which permitted only French ships to trade or transport between French ports. Other countries adopted the concept, later extending it to land and air travel.  Cabotage is a noun; the noun plural is cabotages.

Rights

Example of a cabotage arrangement.

Originally a term applied exclusively to shipping along coastal routes, cabotage can now refer also to aviation and land transport.  It is the transport of passengers and/or goods between two places in one country, undertaken by vessels from a different country.  Cabotage rights are those which define the extent to which transport operators from one country can trade in another and many arrangements exist.  In aviation, it is the right to operate within the domestic borders of another country; most states don’t permit aviation cabotage, and strict sanctions exist, historically either for reasons of economic protectionism, national security, or public safety.  One exception is the European Union, the member states of which grant cross-vested rights to all others, cabotage rights remaining otherwise rare in passenger aviation.  The Chicago Convention on Civil Aviation prohibits member states from granting cabotage on an exclusive basis, which has meant it’s not been used in bilateral aviation negotiations and is not granted under most open skies agreements.  The Closer Economic Relations agreement between Australia and New Zealand permits Australian carriers to fly domestically and internationally from New Zealand and vice versa. Additionally, there are limited rights for the airlines to service domestic routes within both countries.

Hangry

Hangry (pronounced hang-gree)

Feeling irritable or irrationally angry because of hunger.

1915-1920: A portmanteau word, the construct being from h(ungry) + angry.  Hungry is from the Middle English hungry, from the Old English hungriġ & hungreġ (hungry; famishing; meager), from the Proto-Germanic hungragaz (hungry).  It was cognate with the Dutch hongerig, the German hungrig and the Swedish hungrig, all of which meant “hungry”.  Anger is from the Old Norse angr (affliction, sorrow).

Hungry (pre 950) was from the Middle English hungry & hungri, from the Old English hungriġ & hungreġ (hungry; famishing; meager) which existed also in the Common West Germanic and was from the Proto-Germanic hungragaz (hungry).  It was cognate with the German hungrig, the Old Frisian hungerig, the Dutch hongerig, the German hungrig and the Swedish hungrig, all of which meant “hungry”.  The use as a figurative form is noted from circa 1200.

Angry (1350-1400) in the sense of "hot-tempered, irascible; incensed, openly wrathful" is a construct of the earlier noun anger + -y,  The Old Norse adjective was ongrfullr (sorrowful) (the Old Norse angr meant “affliction, sorrow”), from the mid thirteenth century a Middle English form was angerful (anxious, eager).  The “angry young man” dates from 1941 but became a popular form only after John Osborne's (1929-1994) play Look Back in Anger was performed in 1956 although the exact phrase does appears nowhere in the text.  The rare related form is angriness.

The –y suffix is from the Middle English –y & -i, from the Old English -iġ (-y, -ic), from the Proto-Germanic -īgaz (-y, -ic), from the primitive Indo-European -kos, -ikos, & -iḱos (-y, -ic).  It was cognate with the Scots -ie (-y), the West Frisian -ich (-y), the Dutch -ig (-y), the Low German -ig (-y), the German -ig (-y), the Swedish -ig (-y), the Latin -icus (-y, -ic) and the Ancient Greek -ικός (-ikós); a doublet of -ic.  The –y suffix was added to (1) nouns and adjectives to form adjectives meaning “having the quality of” and (2) verbs to form adjectives meaning "inclined to".

The cats Hillary & Bill: a question understandably frequent in some marriages.

Etymologists list hangry as a humorous invention in US English dating from circa 1915-1920 but use soon died out, not to be revived until 1956 when it was mentioned in the US psychoanalytic journal American Imago in a discussion about various kinds of deliberate and accidental wordplay.  Hangry, unlike some of contractions or elisions documented, survived (or was again revived) in the internet age, becoming popular from the mid-1990s and achieved sufficient linguistic critical-mass for the Oxford English Dictionary (OED) to accept it as a word in their 2018 update.  Even among those who dismiss hangry as slang, the usual rules of English should apply so the comparative is more hangry, the superlative most hangry, and the adjectives hangrier and hangriest.

Hangriness can lead to "diva-like behavior".  The Australian New Idea is a "women's magazine" offered still in a print edition as well as on-line.  Locally, the slang for the publication is "The No Idea".

Some dictionaries still resist, apparently not convinced it’s yet a proper word despite the usually authoritative imprimatur of the OED.  For those who side with the OED, of note is that hangry thus becomes only the third word in English to end in –gry, the other two being, predictably, angry and hungry.  There is the odd instance in the historic record of puggry (a light scarf wound around a hat or helmet to protect the head from the sun) but etymologists overwhelmingly say this is a mistake, a Raj-era corruption of the correct puggaree, from the Hindi, Urdu and Punjabi pagṛī (turban), related to the Punjabi pagg (turban) and Kashmiri pag (turban), all of unknown origin.  Angry, hungry & hangry are the only words in English ending in "gry". 

Bacchanal

Bacchanal pronounced (bah-kuh-nahl, bak-uh-nal, bak-uh-nl (noun) or bak-uh-nl (adjective))

(1) A follower of Bacchus.

(2) A drunken reveler.

(3) An occasion of drunken revelry; orgy; riotous celebration.

(4) Of or pertaining to Bacchus; bacchanalian.

1530-1540: From the Latin Bacchānālis (having to do with Bacchus) & Bacchānālia (feast of Bacchus), plural of Bacchānal (a place devoted to Bacchus), from Bacchus (the god of wine), from the Ancient Greek Βάκχος (Bákkhos).  By extension, the meaning "riotous, drunken roistering or orgy" dates from 1711.  Bacchus, known also as Dionysus (Διόνυσος) (Dionysos) was in Greek Mythology the god of the grape harvest, winemaking and wine, of ritual madness, fertility, theatre and religious ecstasy.  In Antiquity, most attention focused on wine and given consumption was both high and enthusiastic, the worship of Bacchus became firmly established.  A quirk of Bacchus’ place in the pantheon of gods is that, uniquely, he was born of a mortal mother.  The Romans adopted the name bacchanal (a woman given to such things was a bacchante) and named the behavior of those who had taken too much strong drink: bakkheia.  Bacchanal is a noun & adjective, Bacchanalia is a noun; the noun plural is bacchanals.

Bacchus and Ariadne

Bacchus and Ariadne (1717) by Giovanni Antonio Pellegrini (1675-1741).

In Greek mythology, Ariadne was the clever, though perhaps naïve, daughter of King Minos of Crete and she aided the hero Theseus in his mission to slay the Minotaur.  To say naïve might be understating things: poor sweet Ariadne was an emo and a bit of a dill.  On the island of Crete, there was a great labyrinth that housed a fearsome beast, the Minotaur, half human, half bull.  King Minos, in retaliation for his son's death at the hands of an Athenian, required the people of Athens every nine years to send seven young men and seven young virgins to be sacrificed to the beast, the alternative the destruction of their city.  One year, Theseus volunteered to be sent to Crete as part of the awful pact, planning to kill the Minotaur and thereby release his people from their plight.  When he stepped ashore in Crete, Ariadne spotted him and at once fell in love, as emos often do; running to Theseus, she offered to help him defeat the monster if he would marry her.  Theseus naturally agreed so Ariadne gave him a sword and a ball of red thread with which to mark his path so he could find his way out of the labyrinth.  The plan worked to the extent that Theseus slayed the Minotaur but certainly had no intention of marrying Ariadne.  While the couple traveled to Athens, during a brief stop on the island of Naxos, he sailed away, abandoning her while she slumbered on the beach.  Ariadne may have been an emo but Theseus was a cad.  Distraught by being deserted by the one she loved, Ariadne was still sobbing on the shore Bacchus appeared with a procession of his followers.  They spoke a few words and within moments had fallen in love, soon to marry.  In some tellings of the myths, after their wedding, Bacchus placed Ariadne's sparkling diadem in the sky as the constellation Corona, thus making her immortal.

A bacchante illustrating the consequences of what the Ancient Romans called bakkheia: Lindsay Lohan in a Cadillac Escalade, resting after dinner, Los Angeles, May 2007.

Inflammable & Flammable

Inflammable (pronounced in-flam-uh-buhl)

(1) Easily set on fire; combustible; incendiary, combustible, inflammable, burnable, ignitable (recommended only for figurative use).

(2) Easily aroused or excited, as to passion or anger; irascible; fiery; volatile, choleric.

1595–1605: From the Medieval Latin inflammābilis, the construct being the Classical Latin inflammā(re) (to set on fire) + -bilis (from the Proto-Italic -ðlis, from the primitive Indo-European i-stem form -dhli- of -dhlom (instrumental suffix).  Akin to –bulum, the suffix -bilis is added to a verb to form an adjectival noun of relationship to that verb (indicating a capacity or worth of being acted upon).  The construct of the Classical Latin inflammare (to set on fire) was -in (in, on) + flamma (flame).  As an indication of shifts in use, the verb inflame & noun inflammation are now most commonly used in clinical medicine to describe swellings, a site especially "reddish" often called "angry".  Inflammable is a noun & adjective, inflammation, inflammableness & inflammasome & inflammability are nouns, inflammatory is an adjective and inflammably is an adverb; the noun plural is inflammables. 

Flammable (pronounced flam-uh-buhl)

Easily set on fire; combustible; incendiary, combustible, inflammable, burnable, ignitable (technically a back-formation from inflammable).

1805–1815: From the Classical Latin flammā(re) (to set on fire) + -ble (the Latin suffix forming adjectives and means “capable or worthy of”).  Flammable is an adjective, flammability is a noun and flammably is an adverb; the noun plural is flammabilities.

Google ngram (a quantitative and not qualitative measure): Because of the way Google harvests data for their ngrams, they’re not literally a tracking of the use of a word in society but can be usefully indicative of certain trends, (although one is never quite sure which trend(s)), especially over decades.  As a record of actual aggregate use, ngrams are not wholly reliable because: (1) the sub-set of texts Google uses is slanted towards the scientific & academic and (2) the technical limitations imposed by the use of OCR (optical character recognition) when handling older texts of sometime dubious legibility (a process AI should improve).  Where numbers bounce around, this may reflect either: (1) peaks and troughs in use for some reason or (2) some quirk in the data harvested.

Need for standardization

Flammable and inflammable came to the same thing.  English, a mongrel vacuum-cleaner of a language, has many anomalies born of the haphazard adoption of words from other tongues but the interchangeability of flammable and inflammable is unfortunate because of the use in signs to warn people of potentially fatal danger.

Using flammable and inflammable to mean the same thing is confusing and at least potentially dangerous and the recommended use is flammable (things prone to catching fire) and non-flammable (things not).  To add another layer of meaning less language-dependent, borrowing from semiotics, danger should be indicated with red, safety with green.

In- often is used as a prefix with adjectives and nouns to indicate the opposite of the word it precedes (eg inaction, indecisive, inexpensive etc).  Given that, it would seem reasonable to assume inflammable is the opposite of flammable and the reason for the potentially deadly duplication is historic.  Inflammable actually pre-dates flammable, the word derived from the Latin verb inflammare (to set on fire), this verb also the origin of the modern meaning “to swell or to provoke angry feelings”, hence the link between setting something on fire and rousing strong feelings in someone.  So, at a time when Latin was more influential, inflammable made sense.  However, as the pull of Latin receded, words with in- (as a negative prefix) became a bigger part of the lexicon and the confusion was created; by early in the 1800s, flammable increasingly came to be used and in the next century, as the use and storage of flammable substances grew, use was widespread.  The modern convention is (or should be) to use flammable literally (to refer to things which catch fire) and inflammable figuratively (to describe the arousal of passions, the swelling of tissue etc.  Surprisingly, the rules applying to warning signs have yet to adopt this standardization.

The Mean Girls (2004) Burn Book (left) and Lindsay Lohan burning an “inflammatory” tabloid magazine, Lindsay Lohan: The Obsession, GQ Magazine, October 2006.

Uses figurative and literal: In Mean Girls, the Burn Book gained its notoriety from being packed with inflammatory comments.  Lindsay Lohan in 2006 picked up the concept in a photo-shoot by Terry Richardson (b 1965) for GQ (Gentlemen's Quarterly) magazine.  Titled Lindsay Lohan: The Obsession, the theme was her as a case-study of the way “tabloid publications” handled celebrity culture, the joke being a magazine with “inflammatory content about her” being literally set aflame, the glossy paper of course being flammable.  It’s appears a consensus in the “media studies” crew that this aspect of “tabloid culture” peaked in the first dozen-odd years of the twenty-first century, the reasons for that including (1) the period having an exceptionally large cast of suitable subjects, (2) smart phones with HD (high-definition) cameras becoming consumer items meaning potential content proliferated (ie what once would not have been photographed now became available to editors as low cost images) and (3) social media sites not having attained critical mass, all factors which at the time enabled the lower-end glossies to flourish.

1972 Ford Ranchero 500 (left) and a circa 1972 Ford Pinto (right).

“Hot Rod Flames” first became popular when the West Coast hot rod community began adding them to their modified machines.  Rendered usually in red, orange and yellow to emulate actual flames, in the decades since they’ve appeared in many colors, sometimes in hues which would never be seen in nature and they’re now a commodity with templates and adhesives widely available; the motif was also picked up by the tattoo community.  Traditionally, when applied to a hot rod or other modified vehicle, the placement of the lick of the flames was quasi-realistic in that the effect was intended to be that of a flaming car in motion.  One widely circulated image however was of a Ford Pinto (1970-1980) with the flames travelling “the other way”: from the back towards the passengers.  The artwork was a sardonic comment on the Pinto’s reputation for bursting aflame if struck from behind by another vehicle, the allegation being Pintos were unusually flammable (the media tended to prefer the more dramatic “explosive”) in such cases because of the placement of the gas (petrol) tank and design of the fuel system.  In truth the Pinto’s susceptibility probably was little different from that of many other vehicles with a similar layout but what gained the modest machine notoriety was the discovery of “inflammatory” comments in internal corporate memorandum in which executives discussed the relative costs of rectifying the problem compared with the likely costs of legal settlements compensating incinerated victims and their families.

Portmanteau

Portmanteau (pronounced pawrt-man-toh)

(1) A case or bag to carry clothing in while traveling, made usually from stiff leather, hinged at the back so as to open out into two compartments

(2) A word created by blending two or more existing words.

1580s (for the travelling case (flexible traveling case or bag for clothes and other necessaries)): From the Middle French portemanteau (travelling bag, literally "(it) carries (the) cloak").  The original meaning from the 1540s was “court official who carried a prince's mantle" from porte, (imperative of porter (to carry) + manteau (cloak)).  The correct plural is portmanteaux but in modern English use, portmanteaus (following the conventions for constructing plurals in English) is now more common.  In the nineteenth century, the word was sometimes Englished as portmantle, a use long extinct.  The notion of the portmanteau word (word blending the sound of two different words) was coined by Lewis Carroll (pen-name of Charles L. Dodgson; 1832-1898) in 1871 for the constructions he invented for Alice Through the Looking-Glass such as Jabberwocky, his poem about the fabulous beast the Jabberwock.  Portmanteau in this sense has existed as a noun since 1872.

Vintage Louis Vuitton Portmanteau, typically circa US$50-80,000 depending on condition.

A portmanteau word, a linguistic blend, differs from contractions and compounds.  Contractions are formed from words that would otherwise appear together in sequence, such as do + not to make don't, whereas a portmanteau word is joins two or more words that relate to the one contractual theme.  A compound word is merely the joining for words in their original form (eg under + statement) without any truncation of the blended words.  Portmanteau words (eg breakfast & lunch to create brunch) always modifies at least one of the original stems.

Lindsay Lohan's handy moniker Lilo (the construct being Li(ndsay) + Lo(han) and it's used sometimes as LiLo) is a portmanteau word.

The word portmanteau was first used in this sense by Lewis Carroll in Alice Through the Looking-Glass (1871) where the concept is helpfully explained by Humpty Dumpty.  Less erudite but just as amusing was the creation of refudiate by Sarah Palin when she got confused and conflated refute and repudiate although it’s unclear whether she knew the meaning of either.  Even those created or used by more literate folk are not always accepted.  Irregardless (portmanteau of regardless and irrespective) seems to stir strong feelings of antipathy in pedants who generally won’t accept it even as a non-standard form and insist it’s simply wrong.  Other languages also create blended forms as needed.  The title of Emile Habibi’s 1974 novel was translated from Arabic utashaʔim (pessimist) + mutafaʔil (optimist) into English as The Pessoptimist.  Arabic linguistic traditions however prefer acronyms and compounds which sometimes overlap.  The group known variously as ISIL or ISIS (although they came to prefer "caliphate" or "Islamic State" (IS)) first adopted the name ad-Dawlah al-Islāmiyah fī 'l-ʿIrāq wa-sh-Shām (Islamic State if Iraq and the Levant) which is usually written as Daesh or Da'ish.  IS think this derogatory as it resembles the Arabic words daes (one who tramples underfoot) and dāhis (those who sows discord).  IS threatened to punish those who use Daesh or Da'ish with a public flogging; repeat offenders promised the cutting out of the tongue.

In the manufacture of big words, English is unlikely ever to match the Germans.  Until changes in EU regulations rendered it obsolete, the longest word in the Fourth Reich was rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz (law delegating beef label monitoring).  Currently, the longest word accepted by German dictionaries is kraftfahrzeughaftpflichtversicherung (automobile liability insurance), editors rejecting donaudampfschifffahrtsgesellschaftskapitaenswitwe (widow of a Danube steamboat company captain) because of rarity of use.