Showing posts sorted by date for query Refudiate. Sort by relevance Show all posts
Showing posts sorted by date for query Refudiate. Sort by relevance Show all posts

Tuesday, May 10, 2022

Portmanteau

Portmanteau (pronounced pawrt-man-toh)

(1) A case or bag to carry clothing in while traveling, made usually from stiff leather, hinged at the back so as to open out into two compartments

(2) A word created by blending two or more existing words.

1580s (for the travelling case (flexible traveling case or bag for clothes and other necessaries)): From the Middle French portemanteau (travelling bag, literally "(it) carries (the) cloak").  The original meaning from the 1540s was “court official who carried a prince's mantle" from porte, (imperative of porter (to carry) + manteau (cloak)).  The correct plural is portmanteaux but in modern English use, portmanteaus (following the conventions for constructing plurals in English) is now more common.  In the nineteenth century, the word was sometimes Englished as portmantle, a use long extinct.  The notion of the portmanteau word (word blending the sound of two different words) was coined by Lewis Carroll (pen-name of Charles L. Dodgson; 1832-1898) in 1871 for the constructions he invented for Alice Through the Looking-Glass such as Jabberwocky, his poem about the fabulous beast the Jabberwock.  Portmanteau in this sense has existed as a noun since 1872.

Vintage Louis Vuitton Portmanteau, typically circa US$50-80,000 depending on condition.

A portmanteau word, a linguistic blend, differs from contractions and compounds.  Contractions are formed from words that would otherwise appear together in sequence, such as do + not to make don't, whereas a portmanteau word is joins two or more words that relate to the one contractual theme.  A compound word is merely the joining for words in their original form (eg under + statement) without any truncation of the blended words.  Portmanteau words (eg breakfast & lunch to create brunch) always modifies at least one of the original stems.

Lindsay Lohan's handy moniker Lilo (the construct being Li(ndsay) + Lo(han) and it's used sometimes as LiLo) is a portmanteau word.

The word portmanteau was first used in this sense by Lewis Carroll in Alice Through the Looking-Glass (1871) where the concept is helpfully explained by Humpty Dumpty.  Less erudite but just as amusing was the creation of refudiate by Sarah Palin when she got confused and conflated refute and repudiate although it’s unclear whether she knew the meaning of either.  Even those created or used by more literate folk are not always accepted.  Irregardless (portmanteau of regardless and irrespective) seems to stir strong feelings of antipathy in pedants who generally won’t accept it even as a non-standard form and insist it’s simply wrong.  Other languages also create blended forms as needed.  The title of Emile Habibi’s 1974 novel was translated from Arabic utashaʔim (pessimist) + mutafaʔil (optimist) into English as The Pessoptimist.  Arabic linguistic traditions however prefer acronyms and compounds which sometimes overlap.  The group known variously as ISIL or ISIS (although they came to prefer "caliphate" or "Islamic State" (IS)) first adopted the name ad-Dawlah al-Islāmiyah fī 'l-ʿIrāq wa-sh-Shām (Islamic State if Iraq and the Levant) which is usually written as Daesh or Da'ish.  IS think this derogatory as it resembles the Arabic words daes (one who tramples underfoot) and dāhis (those who sows discord).  IS threatened to punish those who use Daesh or Da'ish with a public flogging; repeat offenders promised the cutting out of the tongue.

In the manufacture of big words, English is unlikely ever to match the Germans.  Until changes in EU regulations rendered it obsolete, the longest word in the Fourth Reich was rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz (law delegating beef label monitoring).  Currently, the longest word accepted by German dictionaries is kraftfahrzeughaftpflichtversicherung (automobile liability insurance), editors rejecting donaudampfschifffahrtsgesellschaftskapitaenswitwe (widow of a Danube steamboat company captain) because of rarity of use.

Sunday, February 6, 2022

Refudiate

Refudiate (pronounced ri-fyoo-dee-yet)

To reject as untrue or refuse to acknowledge (non-standard).

Late 1800s: The construct was ref(ute) + (rep)udiate.  Refudiate is regarded by most as a non-standard form. Refute was from the Latin refūtō (refute, repudiate), the construct being re- + futo (to beat).  In its original Roman form it meant either (1) to prove something to be false or incorrect or (2) to claim that something is false or incorrect.  However, in English, many authorities assert that only the first meaning applies and that something can be thought refuted only if whatever matter is being discussed is absolutely proved false; it is not enough merely to assert a refutation, a successful refutation is the quality of the assertion.  Refute is often confused with rebut; a rebuttal, in formal debate terms, is a counter-refutation, and it also has a specific legal sense, though like refutation, the word has taken on the informal and disputed meaning of denial.  Politicians and others are much given to saying they refute things by which they really mean “deny” but the practice seems here to stay.  Repudiate was from the Latin repudiātus, from repudiō (I cast off, reject), from repudium (divorce).  It means either (1) to reject the truth or validity of; to deny or (2), to refuse to have anything to do with; to disown.  It also has a (now less common) technical meaning in the jargon of commerce “to refuse to pay or honor (a debt)”.  Refudiate is a non-standard verb and the derived forms are thus also irregular: Refudiation & refudiator are nouns and refudiated & refudiating are verbs; the noun plural is refudiations.

The re- prefix was from the Middle English re-, from the circa 1200 Old French re-, from the Latin re- & red- (back; anew; again; against), from the primitive Indo-European wre & wret- (again), a metathetic alteration of wert- (to turn).  It displaced the native English ed- & eft-.  A hyphen is not normally included in words formed using this prefix, except when the absence of a hyphen would (1) make the meaning unclear, (2) when the word with which the prefix is combined begins with a capital letter, (3) when the word with which the is combined with begins with another “re”, (4) when the word with which the prefix is combined with begins with “e”, (5) when the word formed is identical in form to another word in which re- does not have any of the senses listed above.  As late as the early twentieth century, the dieresis was sometimes used instead of a hyphen (eg reemerge) but this is now rare except when demanded for historic authenticity or if there’s an attempt deliberately to affect the archaic.  Re- may (and has) been applied to almost any verb and previously irregular constructions appear regularly in informal use; the exception is all forms of “be” and the modal verbs (can, should etc).  Although it seems certain the origin of the Latin re- is the primitive Indo-European wre & wret- (which has a parallel in Umbrian re-), beyond that it’s uncertain and while it seems always to have conveyed the general sense of "back" or "backwards", there were instances where the precise was unclear and the prolific productivity in Classical Latin tended make things obscure.

There is in English a school of thought which acknowledges refudiate as a genuine word, the argument being that many words have been created thus and an infrequency of use does not mean a word is not a correct construction, just that it may be considered rare, obsolete or extinct.  Refudiate of course is no pure-bred descendent from the classical languages of antiquity but apparently an inadvertently created blend of refute and repudiate, probably of nineteenth century origin.  Had it been a deliberate coinage to fill some gap in the lexicon, the guardians of English may have been more welcoming but in merging two words which both have disputed meanings, refudiate added nothing but another layer of potential misunderstanding.  Refudiate is often associated with Sarah Palin (b 1964; governor of Alaska 2006-2009 & 2008 Republican US vice presidential nominee) and she was apparently the most recent to use the word but her lapsus linguae (slips of the tongue) were actually quite rare and one suspects criticism of her was excessive given it was after a word with a history stretching back over a century and it’s been done before.  Warren Harding (1865-1921; POTUS 1921-1923), during the 1920 presidential campaign, used “normalcy” instead of “normality”.  The section of the speech with the offending word was almost aggressively alliterative…

America’s present need is not heroics, but healing; not nostrums, but normalcy; not revolution, but restoration; not agitation, but adjustment; not surgery, but serenity; not the dramatic, but the dispassionate; not experiment, but equipoise; not submergence in internationality, but sustainment in triumphant nationality.”

… so in saying "normalcy" he may have misspoken or perhaps Harding liked the word; questioned afterwards he said he found it in a dictionary which probably was true although whether his discovery came before or after the speech wasn't explored.  Although Harding’s choice was much-derided at the time, normalcy had certainly existed since at least 1857, originally as a technical term from geometry meaning the "mathematical condition of being at right angles, state or fact of being normal in geometry" but subsequently it had appeared in print as a synonym of normality on several occasions.  Still, it was hardly in general use though Harding gave it a boost and it’s not since gone extinct, now with little complaint except from the most linguistically fastidious.  The prospects for refudiate don’t seem as hopeful but who knows?  It may catch on in the Republican Party as a statement of anti-elitist inverted linguistic snobbery.

Lindsay Lohan and her lawyer in court, Los Angeles, December 2011.

Politicians often mangle the language and George W Bush (b 1946; POTUS 2001-2009) was so prolific he attracted those who created lists of “bushisms” although the actual coining of words was rare.  He started as he probably didn’t intend to go on, on election night 2000 inventing “misunderestimated” but it seems “ridiculoustic” and “misunfortunistically” were apocryphal.  Most of the Bushisms were either malapropisms or just tangled syntax but one must be sympathetic.  Unlike those who sit at keyboards, able to correct every mistake and polish every sentence, those who speak to live audience, do so sometimes without notes so errors are inevitable.  George W. Bush certainly seems to have made more mistakes with the English language than most (including a great many non-native speakers) but extemporaneous speech is an art more challenging than the most accomplished can make it appear.  The word Bushism caught on but apparently, among White House staffers, the original term was “W-isms” but that never became a thing, probably because it was phonetically inefficient in the same way the three-syllable “world wide web” was always preferred to “www which demanded nine.  Some tried to make dub-dub-dub happen but it never did.

Even when a word is used correctly, the myth of mistake can arise.  Ich bin ein Berliner was a speech delivered in West Berlin on 26 June 1963 by John Kennedy (JFK, 1917–1963; POTUS 1961-1963), one of the most famous of the High Cold War.  The words spoken by Kennedy were: Two thousand years ago, the proudest boast was 'Civis Romanus sum' [I am a Roman citizen].  Today, in the world of freedom, the proudest boast is 'Ich bin ein Berliner' [I am a Berliner]."

Die Krapfen: a plate of Krapfen.

Years later, because of some dialogue in Len Deighton's (1929-2026) spy novel Berlin Game (1983), the myth began that Kennedy’s words were understood by his audience as “I am a jam-filled donut”, based on the fact that in Germany, a Berliner Pfannkuchen is a jam (jelly) filled donut.  However, in Berlin at the time, the term Berliner Pfannkuchen wasn’t commonly in use and to Cold War Berliners, the sweet treat was the Krapfen.  The story however caught on and went viral in a pre-internet sort of way, the imprimatur of authenticity granted by sources as authoritative as Newsweek, the New York Times and Alastair Cooke’s (1908-2004) Letter from America (broadcast internationally by the BBC (British Broadcasting Corporation) 1946-2004)).

Berliner Gedenktafel - Marlene Dietrich.

Were there any doubts about Ich bin ein Berliner being a correct form (in the geographical sense), the matter was in 2002 settled by the Berliner Gaswerke Aktiengesellschaft (GASAG, the Berlin Gasworks Corporation, founded 1847).  Ten years after the death of Marlene Dietrich (1901–1992), the corporation provided the funds for the installation of a memorial plaque at Leberstraße 65 in Berlin-Schöneberg, the site of the actress’s birth.  She was the last of a generation of legendary actresses and after the Berlin city government in 2002 posthumously made her an honorary citizen, a ceremony was held unveiling the Berliner Gedenktafel (Berlin Memorial Plaque).  Translated from the German, the inscription reads:

BERLIN MEMORIAL PLAQUE

Where have all the flowers gone

MARLENE DIETRICH

27 December 1901–6 May 1992

Actress and Singer

She was one of the few German actresses who attained international significance.
Despite tempting offers by the Nazi regime, she emigrated to the USA and became an American citizen.
In 2002, the city of Berlin posthumously made her an honorary citizen.
"I am, thank God, a Berliner."

Funded by the GASAG Berlin Gasworks Corporation